Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Carcinoembryonic antigen-related cell adhesion molecule 3

Gene

CEACAM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, including Neissiria, Moxarella and Haemophilus species, thus playing an important role in the clearance of pathogens by the innate immune system. Responsible for RAC1 stimulation in the course of pathogen phagocytosis.2 Publications

Caution

This is not the ortholog of rat CEACAM3.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-6798695 Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Carcinoembryonic antigen-related cell adhesion molecule 3
Alternative name(s):
Carcinoembryonic antigen CGM1
CD_antigen: CD66d
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CEACAM3
Synonyms:CD66D, CGM1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000170956.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1815 CEACAM3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609142 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P40198

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini35 – 155ExtracellularSequence analysisAdd BLAST121
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei156 – 176HelicalSequence analysisAdd BLAST21
Topological domaini177 – 252CytoplasmicSequence analysisAdd BLAST76

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi230Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-241. 2 Publications1
Mutagenesisi241Y → F: Loss of phosphorylation and 30% reduction in bacterial uptake. More than 60% reduction in bacterial uptake and loss of RAC1 stimulation; when associated with F-230. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
1084

Open Targets

More...
OpenTargetsi
ENSG00000170956

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26359

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
218511974

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 34By similarityAdd BLAST34
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001456535 – 252Carcinoembryonic antigen-related cell adhesion molecule 3Add BLAST218

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi104N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi111N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Tyrosine-phosphorylated in response to microbial binding. Tyr-230 and Tyr-241 are both required for phosphorylation to be detected.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P40198

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P40198

PeptideAtlas

More...
PeptideAtlasi
P40198

PRoteomics IDEntifications database

More...
PRIDEi
P40198

ProteomicsDB human proteome resource

More...
ProteomicsDBi
55342
55343 [P40198-2]
55344 [P40198-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P40198

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P40198

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

CGM1a, the predominant CGM1 transcript, is granulocyte-specific. Not detected out of the granulocytic lineage, such as monocytes, lymphocytes, spleen, testis, colon, brain, liver, pancreas, thymus, ovary, placenta, skeletal muscle, prostate, small intestine, heart, lung and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170956 Expressed in 116 organ(s), highest expression level in blood

CleanEx database of gene expression profiles

More...
CleanExi
HS_CEACAM3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P40198 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P40198 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA011041

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with S100A9/calprotectin. This interaction is calcium-dependent, but independent of CEACAM3 phosphorylation.1 Publication

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
P40198, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000349971

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1252
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P40198

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P40198

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 142Ig-like V-typeAdd BLAST108

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The cytosolic domain is involved in S100A9 interaction.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. CEA family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JC48 Eukaryota
ENOG4111ARQ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153087

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233417

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG007922

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P40198

KEGG Orthology (KO)

More...
KOi
K06499

Identification of Orthologs from Complete Genome Data

More...
OMAi
NIYCRMD

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0AMM

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P40198

TreeFam database of animal gene trees

More...
TreeFami
TF336859

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013106 Ig_V-set

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07686 V-set, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P40198-1) [UniParc]FASTAAdd to basket
Also known as: CGM1A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGPPSASPHR ECIPWQGLLL TASLLNFWNP PTTAKLTIES MPLSVAEGKE
60 70 80 90 100
VLLLVHNLPQ HLFGYSWYKG ERVDGNSLIV GYVIGTQQAT PGAAYSGRET
110 120 130 140 150
IYTNASLLIQ NVTQNDIGFY TLQVIKSDLV NEEATGQFHV YQENAPGLPV
160 170 180 190 200
GAVAGIVTGV LVGVALVAAL VCFLLLAKTG RTSIQRDLKE QQPQALAPGR
210 220 230 240 250
GPSHSSAFSM SPLSTAQAPL PNPRTAASIY EELLKHDTNI YCRMDHKAEV

AS
Length:252
Mass (Da):27,091
Last modified:December 16, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i179F0C51C6A062A1
GO
Isoform 2 (identifier: P40198-2) [UniParc]FASTAAdd to basket
Also known as: CGM1B

The sequence of this isoform differs from the canonical sequence as follows:
     142-252: QENAPGLPVG...RMDHKAEVAS → PELPKPSISS...EPEIHSTTCL

Show »
Length:177
Mass (Da):19,403
Checksum:iC0BF243D56686F8C
GO
Isoform 3 (identifier: P40198-3) [UniParc]FASTAAdd to basket
Also known as: CGM1C

The sequence of this isoform differs from the canonical sequence as follows:
     182-252: TSIQRDLKEQ...RMDHKAEVAS → PWSLPQLCLLDVPSLHCPGPPTQPQDSSFHL

Show »
Length:212
Mass (Da):22,754
Checksum:iA146AF256C9F0B62
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0QXR5M0QXR5_HUMAN
Carcinoembryonic antigen-related ce...
CEACAM3
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti49K → N in BAA14321 (PubMed:2050678).Curated1
Sequence conflicti84I → T in BAA14322 (PubMed:2050678).Curated1
Sequence conflicti137Q → H in BAA14322 (PubMed:2050678).Curated1
Sequence conflicti215T → S in AAA51969 (PubMed:8508798).Curated1
Isoform 3 (identifier: P40198-3)
Sequence conflicti199P → L in AAA51970 (PubMed:8508798).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0039057S → P1 PublicationCorresponds to variant dbSNP:rs1041999Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002486142 – 252QENAP…AEVAS → PELPKPSISSNNSNPKEDKD AVAFTCEPEIHSTTCL in isoform 2. 1 PublicationAdd BLAST111
Alternative sequenceiVSP_002487182 – 252TSIQR…AEVAS → PWSLPQLCLLDVPSLHCPGP PTQPQDSSFHL in isoform 3. 1 PublicationAdd BLAST71

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D90277 mRNA Translation: BAA14321.1
D90278 mRNA Translation: BAA14322.1
L00692 mRNA Translation: AAA51969.1
L00693 mRNA Translation: AAA51970.1
AC022516 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57062.1
CH471126 Genomic DNA Translation: EAW57063.1
BC106728 mRNA Translation: AAI06729.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12586.2 [P40198-1]
CCDS62685.1 [P40198-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
C40428
S33323
S33324

NCBI Reference Sequences

More...
RefSeqi
NP_001264092.1, NM_001277163.2 [P40198-3]
NP_001806.2, NM_001815.4 [P40198-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.11

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000344550; ENSP00000341725; ENSG00000170956 [P40198-3]
ENST00000357396; ENSP00000349971; ENSG00000170956 [P40198-1]
ENST00000415495; ENSP00000411641; ENSG00000170956 [P40198-2]
ENST00000630848; ENSP00000485920; ENSG00000170956 [P40198-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1084

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1084

UCSC genome browser

More...
UCSCi
uc032hyd.2 human [P40198-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90277 mRNA Translation: BAA14321.1
D90278 mRNA Translation: BAA14322.1
L00692 mRNA Translation: AAA51969.1
L00693 mRNA Translation: AAA51970.1
AC022516 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57062.1
CH471126 Genomic DNA Translation: EAW57063.1
BC106728 mRNA Translation: AAI06729.1
CCDSiCCDS12586.2 [P40198-1]
CCDS62685.1 [P40198-3]
PIRiC40428
S33323
S33324
RefSeqiNP_001264092.1, NM_001277163.2 [P40198-3]
NP_001806.2, NM_001815.4 [P40198-1]
UniGeneiHs.11

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6AVZX-ray2.05A34-141[»]
6AW0X-ray2.43A/B34-141[»]
6AW1X-ray2.10A/B34-141[»]
6AW3X-ray2.66A34-141[»]
ProteinModelPortaliP40198
SMRiP40198
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP40198, 4 interactors
STRINGi9606.ENSP00000349971

PTM databases

iPTMnetiP40198
PhosphoSitePlusiP40198

Polymorphism and mutation databases

DMDMi218511974

Proteomic databases

MaxQBiP40198
PaxDbiP40198
PeptideAtlasiP40198
PRIDEiP40198
ProteomicsDBi55342
55343 [P40198-2]
55344 [P40198-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000344550; ENSP00000341725; ENSG00000170956 [P40198-3]
ENST00000357396; ENSP00000349971; ENSG00000170956 [P40198-1]
ENST00000415495; ENSP00000411641; ENSG00000170956 [P40198-2]
ENST00000630848; ENSP00000485920; ENSG00000170956 [P40198-3]
GeneIDi1084
KEGGihsa:1084
UCSCiuc032hyd.2 human [P40198-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1084
DisGeNETi1084
EuPathDBiHostDB:ENSG00000170956.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CEACAM3
HGNCiHGNC:1815 CEACAM3
HPAiHPA011041
MIMi609142 gene
neXtProtiNX_P40198
OpenTargetsiENSG00000170956
PharmGKBiPA26359

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410JC48 Eukaryota
ENOG4111ARQ LUCA
GeneTreeiENSGT00940000153087
HOGENOMiHOG000233417
HOVERGENiHBG007922
InParanoidiP40198
KOiK06499
OMAiNIYCRMD
OrthoDBiEOG091G0AMM
PhylomeDBiP40198
TreeFamiTF336859

Enzyme and pathway databases

ReactomeiR-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-6798695 Neutrophil degranulation

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CEACAM3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1084

Protein Ontology

More...
PROi
PR:P40198

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000170956 Expressed in 116 organ(s), highest expression level in blood
CleanExiHS_CEACAM3
ExpressionAtlasiP40198 baseline and differential
GenevisibleiP40198 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF07686 V-set, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCEAM3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P40198
Secondary accession number(s): G5E978, Q3KPH9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: December 16, 2008
Last modified: December 5, 2018
This is version 159 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again