Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger E-box-binding homeobox 1

Gene

ZEB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). Promotes tumorigenicity by repressing stemness-inhibiting microRNAs.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri170 – 193C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri200 – 222C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri240 – 262C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri268 – 292C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25
DNA bindingi581 – 640Homeobox; atypicalAdd BLAST60
Zinc fingeri904 – 926C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri932 – 954C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri960 – 981C2H2-type 7; atypicalPROSITE-ProRule annotationAdd BLAST22

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processDifferentiation, Neurogenesis, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
SignaLinkiP37275
SIGNORiP37275

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger E-box-binding homeobox 1
Alternative name(s):
NIL-2-A zinc finger protein
Negative regulator of IL2
Transcription factor 8
Short name:
TCF-8
Gene namesi
Name:ZEB1
Synonyms:AREB6, TCF8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000148516.21
HGNCiHGNC:11642 ZEB1
MIMi189909 gene
neXtProtiNX_P37275

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

Corneal dystrophy, posterior polymorphous, 3 (PPCD3)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA subtype of posterior corneal dystrophy, a disease characterized by alterations of Descemet membrane presenting as vesicles, opacities or band-like lesions on slit-lamp examination and specular microscopy. Affected patient typically are asymptomatic.
See also OMIM:609141
Corneal dystrophy, Fuchs endothelial, 6 (FECD6)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA corneal disease caused by loss of endothelium of the central cornea. It is characterized by focal wart-like guttata that arise from Descemet membrane and develop in the central cornea, epithelial blisters, reduced vision and pain. Descemet membrane is thickened by abnormal collagenous deposition.
See also OMIM:613270
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06375978N → T in FECD6; no effect on protein expression; no effect on nuclear localization. 3 PublicationsCorresponds to variant dbSNP:rs80194531EnsemblClinVar.1
Natural variantiVAR_072898640Q → H in FECD6; down-regulation of several collagen genes expression. 1 PublicationCorresponds to variant dbSNP:rs779148597Ensembl.1
Natural variantiVAR_063760649P → A in FECD6; no effect on protein expression; no effect on nuclear localization. 2 PublicationsCorresponds to variant dbSNP:rs781750314Ensembl.1
Natural variantiVAR_072899696N → S in FECD6; no effect on protein expression; no effect on nuclear localization. 1 PublicationCorresponds to variant dbSNP:rs567252241Ensembl.1
Natural variantiVAR_063761810Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 PublicationsCorresponds to variant dbSNP:rs199944415Ensembl.1
Natural variantiVAR_063762840Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 PublicationsCorresponds to variant dbSNP:rs118020901EnsemblClinVar.1
Natural variantiVAR_072900905A → G in FECD6; no effect on protein expression; no effect on nuclear localization. 1 PublicationCorresponds to variant dbSNP:rs78449005Ensembl.1
Natural variantiVAR_063763905A → T in FECD6. 1 Publication1

Keywords - Diseasei

Corneal dystrophy, Disease mutation

Organism-specific databases

DisGeNETi6935
MalaCardsiZEB1
MIMi609141 phenotype
613270 phenotype
OpenTargetsiENSG00000148516
Orphaneti98974 Fuchs endothelial corneal dystrophy
98973 Posterior polymorphous corneal dystrophy
PharmGKBiPA162409589

Polymorphism and mutation databases

BioMutaiZEB1
DMDMi6166575

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000472311 – 1124Zinc finger E-box-binding homeobox 1Add BLAST1124

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei31PhosphoserineBy similarity1
Modified residuei33PhosphoserineBy similarity1
Cross-linki186Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki195Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki307Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei313PhosphoserineBy similarity1
Modified residuei322PhosphoserineCombined sources1
Cross-linki331Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki335Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki347Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki347Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki439Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki493Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki504Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki515Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki548Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki553Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei642PhosphoserineCombined sources1
Modified residuei679PhosphoserineCombined sources1
Modified residuei686PhosphoserineBy similarity1
Modified residuei693PhosphoserineBy similarity1
Modified residuei700PhosphoserineBy similarity1
Modified residuei702PhosphothreonineCombined sources1
Modified residuei704PhosphoserineBy similarity1
Cross-linki774Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki774Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP37275
MaxQBiP37275
PaxDbiP37275
PeptideAtlasiP37275
PRIDEiP37275
ProteomicsDBi55272

PTM databases

iPTMnetiP37275
PhosphoSitePlusiP37275

Expressioni

Tissue specificityi

Colocalizes with SMARCA4/BRG1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level). Expressed in heart and skeletal muscle, but not in liver, spleen, or pancreas.1 Publication

Gene expression databases

BgeeiENSG00000148516 Expressed in 238 organ(s), highest expression level in myometrium
CleanExiHS_ZEB1
ExpressionAtlasiP37275 baseline and differential
GenevisibleiP37275 HS

Organism-specific databases

HPAiCAB058686
HPA027524

Interactioni

Subunit structurei

Interacts (via N-terminus) with SMARCA4/BRG1.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112796, 37 interactors
CORUMiP37275
ELMiP37275
IntActiP37275, 4 interactors
MINTiP37275
STRINGi9606.ENSP00000354487

Structurei

Secondary structure

11124
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP37275
SMRiP37275
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP37275

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi989 – 1124Glu-rich (acidic)Add BLAST136

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri170 – 193C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri200 – 222C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri240 – 262C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri268 – 292C2H2-type 4; atypicalPROSITE-ProRule annotationAdd BLAST25
Zinc fingeri904 – 926C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri932 – 954C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri960 – 981C2H2-type 7; atypicalPROSITE-ProRule annotationAdd BLAST22

Keywords - Domaini

Homeobox, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG3623 Eukaryota
ENOG410ZFMZ LUCA
GeneTreeiENSGT00630000089829
HOGENOMiHOG000264256
HOVERGENiHBG004697
InParanoidiP37275
KOiK09299
OMAiECEKPQG
OrthoDBiEOG091G0F7Y
PhylomeDBiP37275
TreeFamiTF331759

Family and domain databases

CDDicd00086 homeodomain, 1 hit
InterProiView protein in InterPro
IPR008598 Di19_Zn_binding_dom
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00046 Homeobox, 1 hit
PF00096 zf-C2H2, 4 hits
PF05605 zf-Di19, 1 hit
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SM00355 ZnF_C2H2, 7 hits
SUPFAMiSSF46689 SSF46689, 1 hit
SSF57667 SSF57667, 4 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 6 hits

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P37275-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADGPRCKRR KQANPRRNNV TNYNTVVETN SDSDDEDKLH IVEEESVTDA
60 70 80 90 100
ADCEGVPEDD LPTDQTVLPG RSSEREGNAK NCWEDDRKEG QEILGPEAQA
110 120 130 140 150
DEAGCTVKDD ECESDAENEQ NHDPNVEEFL QQQDTAVIFP EAPEEDQRQG
160 170 180 190 200
TPEASGHDEN GTPDAFSQLL TCPYCDRGYK RFTSLKEHIK YRHEKNEDNF
210 220 230 240 250
SCSLCSYTFA YRTQLERHMT SHKSGRDQRH VTQSGCNRKF KCTECGKAFK
260 270 280 290 300
YKHHLKEHLR IHSGEKPYEC PNCKKRFSHS GSYSSHISSK KCISLIPVNG
310 320 330 340 350
RPRTGLKTSQ CSSPSLSASP GSPTRPQIRQ KIENKPLQEQ LSVNQIKTEP
360 370 380 390 400
VDYEFKPIVV ASGINCSTPL QNGVFTGGGP LQATSSPQGM VQAVVLPTVG
410 420 430 440 450
LVSPISINLS DIQNVLKVAV DGNVIRQVLE NNQANLASKE QETINASPIQ
460 470 480 490 500
QGGHSVISAI SLPLVDQDGT TKIIINYSLE QPSQLQVVPQ NLKKENPVAT
510 520 530 540 550
NSCKSEKLPE DLTVKSEKDK SFEGGVNDST CLLCDDCPGD INALPELKHY
560 570 580 590 600
DLKQPTQPPP LPAAEAEKPE SSVSSATGDG NLSPSQPPLK NLLSLLKAYY
610 620 630 640 650
ALNAQPSAEE LSKIADSVNL PLDVVKKWFE KMQAGQISVQ SSEPSSPEPG
660 670 680 690 700
KVNIPAKNND QPQSANANEP QDSTVNLQSP LKMTNSPVLP VGSTTNGSRS
710 720 730 740 750
STPSPSPLNL SSSRNTQGYL YTAEGAQEEP QVEPLDLSLP KQQGELLERS
760 770 780 790 800
TITSVYQNSV YSVQEEPLNL SCAKKEPQKD SCVTDSEPVV NVIPPSANPI
810 820 830 840 850
NIAIPTVTAQ LPTIVAIADQ NSVPCLRALA ANKQTILIPQ VAYTYSTTVS
860 870 880 890 900
PAVQEPPLKV IQPNGNQDER QDTSSEGVSN VEDQNDSDST PPKKKMRKTE
910 920 930 940 950
NGMYACDLCD KIFQKSSSLL RHKYEHTGKR PHECGICKKA FKHKHHLIEH
960 970 980 990 1000
MRLHSGEKPY QCDKCGKRFS HSGSYSQHMN HRYSYCKREA EERDSTEQEE
1010 1020 1030 1040 1050
AGPEILSNEH VGARASPSQG DSDERESLTR EEDEDSEKEE EEEDKEMEEL
1060 1070 1080 1090 1100
QEEKECEKPQ GDEEEEEEEE EVEEEEVEEA ENEGEEAKTE GLMKDDRAES
1110 1120
QASSLGQKVG ESSEQVSEEK TNEA
Length:1,124
Mass (Da):124,074
Last modified:July 15, 1999 - v2
Checksum:i0A2714CC37C848D1
GO
Isoform 2 (identifier: P37275-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-87: R → TG

Note: No experimental confirmation available.
Show »
Length:1,125
Mass (Da):124,076
Checksum:i3C327EEBBA18D19B
GO
Isoform 3 (identifier: P37275-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     20-87: VTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDR → G

Show »
Length:1,057
Mass (Da):116,593
Checksum:i7C683713C6562DC8
GO
Isoform 4 (identifier: P37275-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-107: RKEGQEILGPEAQADEAGCTV → I

Show »
Length:1,104
Mass (Da):122,003
Checksum:i3F8DAA9A05DFA6E4
GO
Isoform 5 (identifier: P37275-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MADGPRCKRRKQANPRRNN → MK
     87-87: R → TG

Show »
Length:1,108
Mass (Da):122,084
Checksum:i33855F3B478635C8
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YMN2H0YMN2_HUMAN
Zinc finger E-box-binding homeobox ...
ZEB1
277Annotation score:
H0YMD3H0YMD3_HUMAN
Zinc finger E-box-binding homeobox ...
ZEB1
274Annotation score:
F6TDF5F6TDF5_HUMAN
Zinc finger E-box-binding homeobox ...
ZEB1
289Annotation score:
H0YND9H0YND9_HUMAN
Zinc finger E-box-binding homeobox ...
ZEB1
288Annotation score:
F6U0D0F6U0D0_HUMAN
Zinc finger E-box-binding homeobox ...
ZEB1
53Annotation score:

Sequence cautioni

The sequence BAG62481 differs from that shown. Reason: Frameshift at position 177.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12Q → R in BAC03673 (PubMed:14702039).Curated1
Sequence conflicti81N → S in BAC03673 (PubMed:14702039).Curated1
Sequence conflicti84E → K in BAC03673 (PubMed:14702039).Curated1
Sequence conflicti220T → A in BAG62481 (PubMed:14702039).Curated1
Sequence conflicti390M → T in BAG62481 (PubMed:14702039).Curated1
Sequence conflicti420V → I in AAA20602 (Ref. 2) Curated1
Sequence conflicti472K → R in BAG58962 (PubMed:14702039).Curated1
Sequence conflicti609E → Q in M81699 (PubMed:1840704).Curated1
Sequence conflicti654I → T in AAA20602 (Ref. 2) Curated1
Sequence conflicti672D → H in M81699 (PubMed:1840704).Curated1
Sequence conflicti681L → S in M81699 (PubMed:1840704).Curated1
Sequence conflicti775K → T in BAG62481 (PubMed:14702039).Curated1
Sequence conflicti793 – 794IP → KY in BAG58962 (PubMed:14702039).Curated2
Sequence conflicti797A → N in BAG58962 (PubMed:14702039).Curated1
Sequence conflicti818A → V in BAG62481 (PubMed:14702039).Curated1
Sequence conflicti838I → T in BAC03673 (PubMed:14702039).Curated1
Sequence conflicti1066E → G in BAC03673 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06375978N → T in FECD6; no effect on protein expression; no effect on nuclear localization. 3 PublicationsCorresponds to variant dbSNP:rs80194531EnsemblClinVar.1
Natural variantiVAR_05273190G → R. Corresponds to variant dbSNP:rs12217419Ensembl.1
Natural variantiVAR_072897525G → E Found in a patient with FECD6. 1 Publication1
Natural variantiVAR_031824553K → R. Corresponds to variant dbSNP:rs35753967Ensembl.1
Natural variantiVAR_072898640Q → H in FECD6; down-regulation of several collagen genes expression. 1 PublicationCorresponds to variant dbSNP:rs779148597Ensembl.1
Natural variantiVAR_063760649P → A in FECD6; no effect on protein expression; no effect on nuclear localization. 2 PublicationsCorresponds to variant dbSNP:rs781750314Ensembl.1
Natural variantiVAR_072899696N → S in FECD6; no effect on protein expression; no effect on nuclear localization. 1 PublicationCorresponds to variant dbSNP:rs567252241Ensembl.1
Natural variantiVAR_063761810Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 PublicationsCorresponds to variant dbSNP:rs199944415Ensembl.1
Natural variantiVAR_063762840Q → P in FECD6; no effect on protein expression; no effect on nuclear localization. 2 PublicationsCorresponds to variant dbSNP:rs118020901EnsemblClinVar.1
Natural variantiVAR_072900905A → G in FECD6; no effect on protein expression; no effect on nuclear localization. 1 PublicationCorresponds to variant dbSNP:rs78449005Ensembl.1
Natural variantiVAR_063763905A → T in FECD6. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472791 – 19MADGP…PRRNN → MK in isoform 5. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_04728020 – 87VTNYN…WEDDR → G in isoform 3. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_04728187 – 107RKEGQ…AGCTV → I in isoform 4. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_04518487R → TG in isoform 2 and isoform 5. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D15050 mRNA Translation: BAA03646.1
U12170 mRNA Translation: AAA20602.1
AK091478 mRNA Translation: BAC03673.1
AK296244 mRNA Translation: BAG58962.1
AK300830 mRNA Translation: BAG62481.1 Frameshift.
AL158080 Genomic DNA No translation available.
AL161935 Genomic DNA No translation available.
AL117340 Genomic DNA No translation available.
AL355148 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85989.1
BC112392 mRNA Translation: AAI12393.1
M81699 mRNA No translation available.
CCDSiCCDS44370.1 [P37275-5]
CCDS53505.1 [P37275-2]
CCDS53506.1 [P37275-4]
CCDS53507.1 [P37275-3]
CCDS7169.1 [P37275-1]
PIRiJX0293
RefSeqiNP_001121600.1, NM_001128128.2 [P37275-5]
NP_001167564.1, NM_001174093.1 [P37275-4]
NP_001167565.1, NM_001174094.1
NP_001167566.1, NM_001174095.1 [P37275-3]
NP_001167567.1, NM_001174096.1 [P37275-2]
NP_110378.3, NM_030751.5 [P37275-1]
UniGeneiHs.124503

Genome annotation databases

EnsembliENST00000320985; ENSP00000319248; ENSG00000148516 [P37275-1]
ENST00000361642; ENSP00000354487; ENSG00000148516 [P37275-2]
ENST00000446923; ENSP00000391612; ENSG00000148516 [P37275-5]
ENST00000542815; ENSP00000444891; ENSG00000148516 [P37275-3]
ENST00000560721; ENSP00000452787; ENSG00000148516 [P37275-4]
GeneIDi6935
KEGGihsa:6935
UCSCiuc001ivs.5 human [P37275-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D15050 mRNA Translation: BAA03646.1
U12170 mRNA Translation: AAA20602.1
AK091478 mRNA Translation: BAC03673.1
AK296244 mRNA Translation: BAG58962.1
AK300830 mRNA Translation: BAG62481.1 Frameshift.
AL158080 Genomic DNA No translation available.
AL161935 Genomic DNA No translation available.
AL117340 Genomic DNA No translation available.
AL355148 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW85989.1
BC112392 mRNA Translation: AAI12393.1
M81699 mRNA No translation available.
CCDSiCCDS44370.1 [P37275-5]
CCDS53505.1 [P37275-2]
CCDS53506.1 [P37275-4]
CCDS53507.1 [P37275-3]
CCDS7169.1 [P37275-1]
PIRiJX0293
RefSeqiNP_001121600.1, NM_001128128.2 [P37275-5]
NP_001167564.1, NM_001174093.1 [P37275-4]
NP_001167565.1, NM_001174094.1
NP_001167566.1, NM_001174095.1 [P37275-3]
NP_001167567.1, NM_001174096.1 [P37275-2]
NP_110378.3, NM_030751.5 [P37275-1]
UniGeneiHs.124503

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E19NMR-A586-642[»]
ProteinModelPortaliP37275
SMRiP37275
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112796, 37 interactors
CORUMiP37275
ELMiP37275
IntActiP37275, 4 interactors
MINTiP37275
STRINGi9606.ENSP00000354487

PTM databases

iPTMnetiP37275
PhosphoSitePlusiP37275

Polymorphism and mutation databases

BioMutaiZEB1
DMDMi6166575

Proteomic databases

EPDiP37275
MaxQBiP37275
PaxDbiP37275
PeptideAtlasiP37275
PRIDEiP37275
ProteomicsDBi55272

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000320985; ENSP00000319248; ENSG00000148516 [P37275-1]
ENST00000361642; ENSP00000354487; ENSG00000148516 [P37275-2]
ENST00000446923; ENSP00000391612; ENSG00000148516 [P37275-5]
ENST00000542815; ENSP00000444891; ENSG00000148516 [P37275-3]
ENST00000560721; ENSP00000452787; ENSG00000148516 [P37275-4]
GeneIDi6935
KEGGihsa:6935
UCSCiuc001ivs.5 human [P37275-1]

Organism-specific databases

CTDi6935
DisGeNETi6935
EuPathDBiHostDB:ENSG00000148516.21
GeneCardsiZEB1
HGNCiHGNC:11642 ZEB1
HPAiCAB058686
HPA027524
MalaCardsiZEB1
MIMi189909 gene
609141 phenotype
613270 phenotype
neXtProtiNX_P37275
OpenTargetsiENSG00000148516
Orphaneti98974 Fuchs endothelial corneal dystrophy
98973 Posterior polymorphous corneal dystrophy
PharmGKBiPA162409589
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3623 Eukaryota
ENOG410ZFMZ LUCA
GeneTreeiENSGT00630000089829
HOGENOMiHOG000264256
HOVERGENiHBG004697
InParanoidiP37275
KOiK09299
OMAiECEKPQG
OrthoDBiEOG091G0F7Y
PhylomeDBiP37275
TreeFamiTF331759

Enzyme and pathway databases

ReactomeiR-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
SignaLinkiP37275
SIGNORiP37275

Miscellaneous databases

ChiTaRSiZEB1 human
EvolutionaryTraceiP37275
GeneWikiiZEB1
GenomeRNAii6935
PROiPR:P37275
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148516 Expressed in 238 organ(s), highest expression level in myometrium
CleanExiHS_ZEB1
ExpressionAtlasiP37275 baseline and differential
GenevisibleiP37275 HS

Family and domain databases

CDDicd00086 homeodomain, 1 hit
InterProiView protein in InterPro
IPR008598 Di19_Zn_binding_dom
IPR009057 Homeobox-like_sf
IPR001356 Homeobox_dom
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00046 Homeobox, 1 hit
PF00096 zf-C2H2, 4 hits
PF05605 zf-Di19, 1 hit
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SM00355 ZnF_C2H2, 7 hits
SUPFAMiSSF46689 SSF46689, 1 hit
SSF57667 SSF57667, 4 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 6 hits
ProtoNetiSearch...

Entry informationi

Entry nameiZEB1_HUMAN
AccessioniPrimary (citable) accession number: P37275
Secondary accession number(s): B4DJV0
, B4DUW9, E9PCM7, F5H4I8, Q12924, Q13800, Q2KJ05, Q5T968, Q5VZ84, Q8NB68
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: July 15, 1999
Last modified: October 10, 2018
This is version 191 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again