Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibroblast growth factor 8

Gene

Fgf8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells (By similarity). Cooperates with Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis (PubMed:7884899).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

  • aorta morphogenesis Source: MGI
  • apoptotic process Source: MGI
  • blood vessel remodeling Source: MGI
  • BMP signaling pathway Source: MGI
  • bone development Source: MGI
  • branching involved in blood vessel morphogenesis Source: MGI
  • branching involved in salivary gland morphogenesis Source: MGI
  • branching involved in ureteric bud morphogenesis Source: MGI
  • canonical Wnt signaling pathway Source: MGI
  • cell fate commitment Source: MGI
  • cell migration involved in mesendoderm migration Source: MGI
  • cell proliferation in forebrain Source: MGI
  • central nervous system neuron development Source: MGI
  • corticotropin hormone secreting cell differentiation Source: MGI
  • determination of left/right symmetry Source: MGI
  • dopaminergic neuron differentiation Source: MGI
  • dorsal/ventral axon guidance Source: MGI
  • embryo development ending in birth or egg hatching Source: MGI
  • embryonic heart tube development Source: MGI
  • embryonic hindlimb morphogenesis Source: MGI
  • epithelial to mesenchymal transition involved in endocardial cushion formation Source: MGI
  • fibroblast growth factor receptor signaling pathway Source: MGI
  • forebrain dorsal/ventral pattern formation Source: MGI
  • forebrain morphogenesis Source: MGI
  • forebrain neuron development Source: MGI
  • generation of neurons Source: MGI
  • gonad development Source: MGI
  • heart development Source: MGI
  • heart looping Source: MGI
  • heart morphogenesis Source: MGI
  • inner ear morphogenesis Source: MGI
  • kidney development Source: MGI
  • limb morphogenesis Source: MGI
  • lung development Source: MGI
  • lung morphogenesis Source: MGI
  • male genitalia development Source: MGI
  • MAPK cascade Source: MGI
  • mesodermal cell migration Source: MGI
  • metanephros development Source: Ensembl
  • midbrain-hindbrain boundary development Source: MGI
  • motor neuron axon guidance Source: MGI
  • negative regulation of apoptotic process Source: MGI
  • negative regulation of cardiac muscle tissue development Source: MGI
  • negative regulation of neuron apoptotic process Source: MGI
  • neural plate morphogenesis Source: MGI
  • neuroepithelial cell differentiation Source: MGI
  • odontogenesis Source: Ensembl
  • organ induction Source: MGI
  • otic vesicle formation Source: MGI
  • outflow tract morphogenesis Source: MGI
  • outflow tract septum morphogenesis Source: UniProtKB
  • pallium development Source: MGI
  • pharyngeal system development Source: MGI
  • positive regulation of cell division Source: UniProtKB-KW
  • positive regulation of cell proliferation Source: MGI
  • positive regulation of ERK1 and ERK2 cascade Source: MGI
  • positive regulation of gene expression Source: MGI
  • positive regulation of mitotic nuclear division Source: MGI
  • positive regulation of organ growth Source: MGI
  • regulation of odontogenesis of dentin-containing tooth Source: MGI
  • response to oxidative stress Source: MGI
  • signal transduction involved in regulation of gene expression Source: MGI
  • subpallium development Source: MGI
  • telencephalon development Source: MGI
  • thyroid gland development Source: MGI
  • thyroid-stimulating hormone-secreting cell differentiation Source: MGI

Keywordsi

Molecular functionDevelopmental protein, Growth factor, Mitogen
Biological processDifferentiation

Enzyme and pathway databases

ReactomeiR-MMU-109704 PI3K Cascade
R-MMU-1257604 PIP3 activates AKT signaling
R-MMU-190322 FGFR4 ligand binding and activation
R-MMU-190371 FGFR3b ligand binding and activation
R-MMU-190372 FGFR3c ligand binding and activation
R-MMU-190373 FGFR1c ligand binding and activation
R-MMU-190375 FGFR2c ligand binding and activation
R-MMU-5654219 Phospholipase C-mediated cascade: FGFR1
R-MMU-5654221 Phospholipase C-mediated cascade, FGFR2
R-MMU-5654227 Phospholipase C-mediated cascade, FGFR3
R-MMU-5654228 Phospholipase C-mediated cascade, FGFR4
R-MMU-5654687 Downstream signaling of activated FGFR1
R-MMU-5654688 SHC-mediated cascade:FGFR1
R-MMU-5654689 PI-3K cascade:FGFR1
R-MMU-5654693 FRS-mediated FGFR1 signaling
R-MMU-5654695 PI-3K cascade:FGFR2
R-MMU-5654699 SHC-mediated cascade:FGFR2
R-MMU-5654700 FRS-mediated FGFR2 signaling
R-MMU-5654704 SHC-mediated cascade:FGFR3
R-MMU-5654706 FRS-mediated FGFR3 signaling
R-MMU-5654710 PI-3K cascade:FGFR3
R-MMU-5654712 FRS-mediated FGFR4 signaling
R-MMU-5654719 SHC-mediated cascade:FGFR4
R-MMU-5654720 PI-3K cascade:FGFR4
R-MMU-5654726 Negative regulation of FGFR1 signaling
R-MMU-5654727 Negative regulation of FGFR2 signaling
R-MMU-5654732 Negative regulation of FGFR3 signaling
R-MMU-5654733 Negative regulation of FGFR4 signaling
R-MMU-5658623 FGFRL1 modulation of FGFR1 signaling
R-MMU-5673001 RAF/MAP kinase cascade
R-MMU-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 8
Short name:
FGF-8
Alternative name(s):
Androgen-induced growth factor
Short name:
AIGF
Heparin-binding growth factor 8
Short name:
HBGF-8
Gene namesi
Name:Fgf8
Synonyms:Aigf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 19

Organism-specific databases

MGIiMGI:99604 Fgf8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000000897123 – 268Fibroblast growth factor 8Add BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei23Pyrrolidone carboxylic acidSequence analysis1
Glycosylationi60N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi190N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

The N-terminus is blocked.

Keywords - PTMi

Glycoprotein, Pyrrolidone carboxylic acid

Proteomic databases

PaxDbiP37237
PRIDEiP37237

PTM databases

PhosphoSitePlusiP37237

Expressioni

Tissue specificityi

Absent in normal mammary glands and detected only in adult testis and ovary and in midgestational embryos.

Inductioni

By androgens.

Gene expression databases

BgeeiENSMUSG00000025219
CleanExiMM_FGF8
ExpressionAtlasiP37237 baseline and differential
GenevisibleiP37237 MM

Interactioni

Subunit structurei

Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-6030N
IntActiP37237, 1 interactor
STRINGi10090.ENSMUSP00000026241

Structurei

3D structure databases

ProteinModelPortaliP37237
SMRiP37237
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3885 Eukaryota
ENOG4111IPH LUCA
GeneTreeiENSGT00730000110785
HOGENOMiHOG000115986
HOVERGENiHBG005659
InParanoidiP37237
KOiK04358
OrthoDBiEOG091G0NQH
PhylomeDBiP37237
TreeFamiTF331233

Family and domain databases

CDDicd00058 FGF, 1 hit
InterProiView protein in InterPro
IPR028249 FGF8
IPR002209 Fibroblast_GF_fam
IPR008996 IL1/FGF
PANTHERiPTHR11486 PTHR11486, 1 hit
PTHR11486:SF3 PTHR11486:SF3, 1 hit
PfamiView protein in Pfam
PF00167 FGF, 1 hit
SMARTiView protein in SMART
SM00442 FGF, 1 hit
SUPFAMiSSF50353 SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS00247 HBGF_FGF, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform FGF-8C (identifier: P37237-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP
60 70 80 90 100
FGQRSRAGKN FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS
110 120 130 140 150
RRLIRTYQLY SRTSGKHVQV LANKRINAMA EDGDPFAKLI VETDTFGSRV
160 170 180 190 200
RVRGAETGLY ICMNKKGKLI AKSNGKGKDC VFTEIVLENN YTALQNAKYE
210 220 230 240 250
GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ SLRFEFLNYP
260
PFTRSLRGSQ RTWAPEPR
Length:268
Mass (Da):30,420
Last modified:October 1, 1994 - v1
Checksum:i3330A9F342AD7109
GO
Isoform FGF-8B (identifier: P37237-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQR → VTVQSSPNFTQ

Show »
Length:215
Mass (Da):24,711
Checksum:iA39424271EF7CBFF
GO
Isoform FGF-8A (identifier: P37237-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: Missing.

Show »
Length:204
Mass (Da):23,522
Checksum:i9A4CAB7686A2B190
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00152824 – 87Missing in isoform FGF-8A. CuratedAdd BLAST64
Alternative sequenceiVSP_00152724 – 87VRSAA…KVTQR → VTVQSSPNFTQ in isoform FGF-8B. CuratedAdd BLAST64

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12483 mRNA Translation: BAA02051.1
D12482 mRNA Translation: BAA02050.1
U18673 mRNA Translation: AAA65387.1
Z48746 mRNA Translation: CAA88637.1
CCDSiCCDS29864.1 [P37237-1]
CCDS50450.1 [P37237-3]
CCDS50451.1 [P37237-2]
PIRiA46245
B46245
RefSeqiNP_001159834.1, NM_001166362.1 [P37237-2]
NP_001159835.1, NM_001166363.1 [P37237-3]
NP_034335.1, NM_010205.2 [P37237-1]
UniGeneiMm.4012

Genome annotation databases

EnsembliENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219 [P37237-1]
ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219 [P37237-3]
ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219 [P37237-2]
GeneIDi14179
KEGGimmu:14179
UCSCiuc008hrh.2 mouse [P37237-3]
uc012bmo.1 mouse [P37237-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFGF8_MOUSE
AccessioniPrimary (citable) accession number: P37237
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: October 1, 1994
Last modified: June 20, 2018
This is version 157 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health