Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 175 (02 Jun 2021)
Sequence version 1 (01 Oct 1994)
Previous versions | rss
Add a publicationFeedback
Protein

Fibroblast growth factor 8

Gene

Fgf8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in neurite outgrowth in hippocampal cells (By similarity).

Cooperates with Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis (PubMed:7884899).

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Growth factor, Mitogen
Biological processDifferentiation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-109704, PI3K Cascade
R-MMU-1257604, PIP3 activates AKT signaling
R-MMU-190322, FGFR4 ligand binding and activation
R-MMU-190371, FGFR3b ligand binding and activation
R-MMU-190372, FGFR3c ligand binding and activation
R-MMU-190373, FGFR1c ligand binding and activation
R-MMU-190375, FGFR2c ligand binding and activation
R-MMU-5654219, Phospholipase C-mediated cascade: FGFR1
R-MMU-5654221, Phospholipase C-mediated cascade, FGFR2
R-MMU-5654227, Phospholipase C-mediated cascade, FGFR3
R-MMU-5654228, Phospholipase C-mediated cascade, FGFR4
R-MMU-5654687, Downstream signaling of activated FGFR1
R-MMU-5654688, SHC-mediated cascade:FGFR1
R-MMU-5654689, PI-3K cascade:FGFR1
R-MMU-5654693, FRS-mediated FGFR1 signaling
R-MMU-5654695, PI-3K cascade:FGFR2
R-MMU-5654699, SHC-mediated cascade:FGFR2
R-MMU-5654700, FRS-mediated FGFR2 signaling
R-MMU-5654704, SHC-mediated cascade:FGFR3
R-MMU-5654706, FRS-mediated FGFR3 signaling
R-MMU-5654710, PI-3K cascade:FGFR3
R-MMU-5654712, FRS-mediated FGFR4 signaling
R-MMU-5654719, SHC-mediated cascade:FGFR4
R-MMU-5654720, PI-3K cascade:FGFR4
R-MMU-5654726, Negative regulation of FGFR1 signaling
R-MMU-5654727, Negative regulation of FGFR2 signaling
R-MMU-5654732, Negative regulation of FGFR3 signaling
R-MMU-5654733, Negative regulation of FGFR4 signaling
R-MMU-5658623, FGFRL1 modulation of FGFR1 signaling
R-MMU-5673001, RAF/MAP kinase cascade
R-MMU-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fibroblast growth factor 8
Short name:
FGF-8
Alternative name(s):
Androgen-induced growth factor
Short name:
AIGF
Heparin-binding growth factor 8
Short name:
HBGF-8
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fgf8
Synonyms:Aigf
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:99604, Fgf8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000897123 – 268Fibroblast growth factor 8Add BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei23Pyrrolidone carboxylic acidSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi60N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi190N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The N-terminus is blocked.

Keywords - PTMi

Glycoprotein, Pyrrolidone carboxylic acid

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P37237

PRoteomics IDEntifications database

More...
PRIDEi
P37237

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
271755 [P37237-1]
271756 [P37237-2]
271757 [P37237-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
P37237, 2 sites

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P37237

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Absent in normal mammary glands and detected only in adult testis and ovary and in midgestational embryos.

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By androgens.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000025219, Expressed in rhombomere and 210 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P37237, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P37237, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Homodimer.

Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

Database of interacting proteins

More...
DIPi
DIP-6030N

Protein interaction database and analysis system

More...
IntActi
P37237, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000026241

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P37237, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P37237

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni29 – 87DisorderedSequence analysisAdd BLAST59

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi71 – 85Basic and acidic residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3885, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159518

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_090682_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P37237

Identification of Orthologs from Complete Genome Data

More...
OMAi
NARYESW

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P37237

TreeFam database of animal gene trees

More...
TreeFami
TF331233

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00058, FGF, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028249, FGF8
IPR002209, Fibroblast_GF_fam
IPR008996, IL1/FGF

The PANTHER Classification System

More...
PANTHERi
PTHR11486, PTHR11486, 1 hit
PTHR11486:SF3, PTHR11486:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00167, FGF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00442, FGF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50353, SSF50353, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00247, HBGF_FGF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform FGF-8C (identifier: P37237-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP
60 70 80 90 100
FGQRSRAGKN FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS
110 120 130 140 150
RRLIRTYQLY SRTSGKHVQV LANKRINAMA EDGDPFAKLI VETDTFGSRV
160 170 180 190 200
RVRGAETGLY ICMNKKGKLI AKSNGKGKDC VFTEIVLENN YTALQNAKYE
210 220 230 240 250
GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ SLRFEFLNYP
260
PFTRSLRGSQ RTWAPEPR
Length:268
Mass (Da):30,420
Last modified:October 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3330A9F342AD7109
GO
Isoform FGF-8B (identifier: P37237-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQR → VTVQSSPNFTQ

Show »
Length:215
Mass (Da):24,711
Checksum:iA39424271EF7CBFF
GO
Isoform FGF-8A (identifier: P37237-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-87: Missing.

Show »
Length:204
Mass (Da):23,522
Checksum:i9A4CAB7686A2B190
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q80ZL6Q80ZL6_MOUSE
Fibroblast growth factor
Fgf8
244Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z207D3Z207_MOUSE
Fibroblast growth factor
Fgf8
233Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z208D3Z208_MOUSE
Fibroblast growth factor
Fgf8
140Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00152824 – 87Missing in isoform FGF-8A. CuratedAdd BLAST64
Alternative sequenceiVSP_00152724 – 87VRSAA…KVTQR → VTVQSSPNFTQ in isoform FGF-8B. CuratedAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D12483 mRNA Translation: BAA02051.1
D12482 mRNA Translation: BAA02050.1
U18673 mRNA Translation: AAA65387.1
Z48746 mRNA Translation: CAA88637.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS29864.1 [P37237-1]
CCDS50450.1 [P37237-3]
CCDS50451.1 [P37237-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A46245
B46245

NCBI Reference Sequences

More...
RefSeqi
NP_001159834.1, NM_001166362.1 [P37237-2]
NP_001159835.1, NM_001166363.1 [P37237-3]
NP_034335.1, NM_010205.2 [P37237-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219 [P37237-1]
ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219 [P37237-3]
ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219 [P37237-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14179

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14179

UCSC genome browser

More...
UCSCi
uc008hrh.2, mouse [P37237-3]
uc012bmo.1, mouse [P37237-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D12483 mRNA Translation: BAA02051.1
D12482 mRNA Translation: BAA02050.1
U18673 mRNA Translation: AAA65387.1
Z48746 mRNA Translation: CAA88637.1
CCDSiCCDS29864.1 [P37237-1]
CCDS50450.1 [P37237-3]
CCDS50451.1 [P37237-2]
PIRiA46245
B46245
RefSeqiNP_001159834.1, NM_001166362.1 [P37237-2]
NP_001159835.1, NM_001166363.1 [P37237-3]
NP_034335.1, NM_010205.2 [P37237-1]

3D structure databases

SMRiP37237
ModBaseiSearch...

Protein-protein interaction databases

DIPiDIP-6030N
IntActiP37237, 1 interactor
STRINGi10090.ENSMUSP00000026241

PTM databases

GlyGeniP37237, 2 sites
PhosphoSitePlusiP37237

Proteomic databases

PaxDbiP37237
PRIDEiP37237
ProteomicsDBi271755 [P37237-1]
271756 [P37237-2]
271757 [P37237-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31323, 411 antibodies

The DNASU plasmid repository

More...
DNASUi
14179

Genome annotation databases

EnsembliENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219 [P37237-1]
ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219 [P37237-3]
ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219 [P37237-2]
GeneIDi14179
KEGGimmu:14179
UCSCiuc008hrh.2, mouse [P37237-3]
uc012bmo.1, mouse [P37237-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2253
MGIiMGI:99604, Fgf8

Phylogenomic databases

eggNOGiKOG3885, Eukaryota
GeneTreeiENSGT00940000159518
HOGENOMiCLU_090682_0_1_1
InParanoidiP37237
OMAiNARYESW
PhylomeDBiP37237
TreeFamiTF331233

Enzyme and pathway databases

ReactomeiR-MMU-109704, PI3K Cascade
R-MMU-1257604, PIP3 activates AKT signaling
R-MMU-190322, FGFR4 ligand binding and activation
R-MMU-190371, FGFR3b ligand binding and activation
R-MMU-190372, FGFR3c ligand binding and activation
R-MMU-190373, FGFR1c ligand binding and activation
R-MMU-190375, FGFR2c ligand binding and activation
R-MMU-5654219, Phospholipase C-mediated cascade: FGFR1
R-MMU-5654221, Phospholipase C-mediated cascade, FGFR2
R-MMU-5654227, Phospholipase C-mediated cascade, FGFR3
R-MMU-5654228, Phospholipase C-mediated cascade, FGFR4
R-MMU-5654687, Downstream signaling of activated FGFR1
R-MMU-5654688, SHC-mediated cascade:FGFR1
R-MMU-5654689, PI-3K cascade:FGFR1
R-MMU-5654693, FRS-mediated FGFR1 signaling
R-MMU-5654695, PI-3K cascade:FGFR2
R-MMU-5654699, SHC-mediated cascade:FGFR2
R-MMU-5654700, FRS-mediated FGFR2 signaling
R-MMU-5654704, SHC-mediated cascade:FGFR3
R-MMU-5654706, FRS-mediated FGFR3 signaling
R-MMU-5654710, PI-3K cascade:FGFR3
R-MMU-5654712, FRS-mediated FGFR4 signaling
R-MMU-5654719, SHC-mediated cascade:FGFR4
R-MMU-5654720, PI-3K cascade:FGFR4
R-MMU-5654726, Negative regulation of FGFR1 signaling
R-MMU-5654727, Negative regulation of FGFR2 signaling
R-MMU-5654732, Negative regulation of FGFR3 signaling
R-MMU-5654733, Negative regulation of FGFR4 signaling
R-MMU-5658623, FGFRL1 modulation of FGFR1 signaling
R-MMU-5673001, RAF/MAP kinase cascade
R-MMU-6811558, PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
14179, 0 hits in 53 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fgf8, mouse

Protein Ontology

More...
PROi
PR:P37237
RNActiP37237, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000025219, Expressed in rhombomere and 210 other tissues
ExpressionAtlasiP37237, baseline and differential
GenevisibleiP37237, MM

Family and domain databases

CDDicd00058, FGF, 1 hit
InterProiView protein in InterPro
IPR028249, FGF8
IPR002209, Fibroblast_GF_fam
IPR008996, IL1/FGF
PANTHERiPTHR11486, PTHR11486, 1 hit
PTHR11486:SF3, PTHR11486:SF3, 1 hit
PfamiView protein in Pfam
PF00167, FGF, 1 hit
SMARTiView protein in SMART
SM00442, FGF, 1 hit
SUPFAMiSSF50353, SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS00247, HBGF_FGF, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFGF8_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P37237
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1994
Last sequence update: October 1, 1994
Last modified: June 2, 2021
This is version 175 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again