UniProtKB - P37025 (THPR_ECOLI)

BLAST

>sp|P37025|THPR_ECOLI RNA 2',3'-cyclic phosphodiesterase OS=Escherichia coli (strain K12) OX=83333 GN=thpR PE=1 SV=3
MSEPQRLFFAIDLPAEIREQIIHWRATHFPPEAGRPVAADNLHLTLAFLGEVSAEKEKAL
SLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLANMLRSQAARSGCFQSNR
PFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGRTRYTPLKRWALTQ

Align
Format
Add to basket Added to basket
History
Entry version 126 (07 Nov 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

RNA 2',3'-cyclic phosphodiesterase

Gene

thpR

Organism

Escherichia coli (strain K12)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Hydrolyzes RNA 2',3'-cyclic phosphodiester to an RNA 2'-phosphomonoester (PubMed:25239919). In vitro, can also ligate 5' and 3' half-tRNA molecules with 2',3'-cyclic phosphate and 5'-hydroxyl termini, respectively, to the product containing the 2'-5' phosphodiester linkage. This reaction does not require ATP and is reversible (PubMed:6347395 and PubMed:8940112).3 Publications

Caution

Was originally thought to be a 2',5'-RNA ligase.2 Publications

Catalytic activityⁱ

(Ribonucleotide)(n)-2',3'-cyclic phosphate + H₂O = (ribonucleotide)(n)-2'-phosphate.UniRule annotation1 Publication

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Active siteⁱ	43	Proton donorUniRule annotation1 Publication		1
Active siteⁱ	125	Proton acceptorUniRule annotation1 Publication		1

GO - Molecular functionⁱ

2',3'-cyclic-nucleotide 3'-phosphodiesterase activity
Source: EcoCyc
Inferred from direct assayⁱ
- 25239919
2'-5'-RNA ligase activity
Source: EcoCyc
Inferred from direct assayⁱ
- 8940112

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Hydrolase

Molecular function

Hydrolase

Enzyme and pathway databases

BioCycⁱ	EcoCyc:EG12330-MONOMER MetaCyc:EG12330-MONOMER
BRENDAⁱ	6.5.1.B1 2026

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: RNA 2',3'-cyclic phosphodiesterase1 PublicationUniRule annotation (EC:3.1.4.58UniRule annotation1 Publication) Short name: RNA 2',3'-CPDase1 PublicationUniRule annotation Alternative name(s): Two-histidine 2',3'-cyclic phosphodiesterase acting on RNA1 Publication
Gene namesⁱ	Name:thpR1 PublicationUniRule annotation Synonyms:ligTImported, yadP Ordered Locus Names:b0147, JW5011
Organismⁱ	Escherichia coli (strain K12)
Taxonomic identifierⁱ	83333 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia › Escherichia coli
Proteomesⁱ	UP000000318 Componentⁱ: Chromosome UP000000625 Componentⁱ: Chromosome

Organism-specific databases

EcoGeneⁱ	EG12330 thpR

EcoGeneⁱ

EG12330 thpR

Pathology & Biotechⁱ

Disruption phenotypeⁱ

Disruption abolishes ligase activity in cell lysates, but mutants grow normally under laboratory conditions.1 Publication

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	43	H → A: Lack of CPDase activity. 1 Publication	1
Mutagenesisⁱ	45	T → A: Lack of CPDase activity. 1 Publication	1
Mutagenesisⁱ	48	F → A: Decreases CPDase activity. 1 Publication	1
Mutagenesisⁱ	125	H → A: Lack of CPDase activity. 1 Publication	1
Mutagenesisⁱ	127	T → A: Does not affect CPDase activity. 1 Publication	1
Mutagenesisⁱ	130	R → A: Lack of CPDase activity. 1 Publication	1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed1 Publication
ChainⁱPRO_0000084421	2 – 176	RNA 2',3'-cyclic phosphodiesteraseAdd BLAST		175

Proteomic databases

PaxDbⁱ	P37025
PRIDEⁱ	P37025

Interactionⁱ

Subunit structureⁱ

Monomer.1 Publication

Protein-protein interaction databases

BioGridⁱ	4259744, 115 interactors
STRINGⁱ	316385.ECDH10B_0127

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	5 – 11	Combined sources	7
Helixⁱ	15 – 28	Combined sources	14
Helixⁱ	31 – 33	Combined sources	3
Helixⁱ	39 – 41	Combined sources	3
Beta strandⁱ	44 – 52	Combined sources	9
Helixⁱ	54 – 64	Combined sources	11
Beta strandⁱ	72 – 75	Combined sources	4
Beta strandⁱ	78 – 82	Combined sources	5
Turnⁱ	83 – 86	Combined sources	4
Beta strandⁱ	87 – 91	Combined sources	5
Helixⁱ	97 – 112	Combined sources	16
Beta strandⁱ	126 – 131	Combined sources	6
Beta strandⁱ	146 – 149	Combined sources	4
Beta strandⁱ	151 – 159	Combined sources	9
Beta strandⁱ	161 – 173	Combined sources	13

Show more details

3D structure databases

ProteinModelPortalⁱ	P37025
SMRⁱ	P37025
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	43 – 46	HXTX 1UniRule annotationCurated		4
Motifⁱ	125 – 128	HXTX 2UniRule annotationCurated		4

Sequence similaritiesⁱ

Belongs to the 2H phosphoesterase superfamily. ThpR family.UniRule annotationCurated

Phylogenomic databases

eggNOGⁱ	ENOG4107XID Bacteria COG1514 LUCA
HOGENOMⁱ	HOG000226389
InParanoidⁱ	P37025
KEGG Orthology (KO) More...KOⁱ	K01975
PhylomeDBⁱ	P37025

Family and domain databases

HAMAPⁱ	MF_01940 RNA_CPDase, 1 hit
InterProⁱ	View protein in InterPro IPR009097 cNuc_Pdiesterase IPR014051 Phosphoesterase_HXTX IPR004175 RNA_CPDase
PANTHERⁱ	PTHR35561 PTHR35561, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF02834 LigT_PEase, 2 hits
SUPFAMⁱ	SSF55144 SSF55144, 1 hit
TIGRFAMsⁱ	TIGR02258 2_5_ligase, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P37025-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSEPQRLFFA IDLPAEIREQ IIHWRATHFP PEAGRPVAAD NLHLTLAFLG 
        60         70         80         90        100
EVSAEKEKAL SLLAGRIRQP GFTLTLDDAG QWLRSRVVWL GMRQPPRGLI 
       110        120        130        140        150
QLANMLRSQA ARSGCFQSNR PFHPHITLLR DASEAVTIPP PGFNWSYAVT 
       160        170 
EFTLYASSFA RGRTRYTPLK RWALTQ

Length:176

Mass (Da):19,934

Last modified:January 23, 2007 - v3

Checksum:ⁱ9DAA9FB3CE4F777E

Sequence cautionⁱ

The sequence M60726 differs from that shown. Reason: Frameshift at position 168.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	174	L → V in M60726 (PubMed:2013578).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U00096 Genomic DNA Translation: AAC73258.2 AP009048 Genomic DNA Translation: BAB96724.2 M60726 Genomic DNA No translation available.
PIRⁱ	C64738
NCBI Reference Sequences More...RefSeqⁱ	NP_414689.4, NC_000913.3 WP_001294700.1, NZ_LN832404.1

Genome annotation databases

EnsemblBacteriaⁱ	AAC73258; AAC73258; b0147 BAB96724; BAB96724; BAB96724
GeneIDⁱ	944848
KEGGⁱ	ecj:JW5011 eco:b0147
PATRICⁱ	fig\|1411691.4.peg.2134

Protein	Similar proteins		Species	Score	Length	Source
P37025	RNA 2',3'-cyclic phosphodiesterase		SHISO		247	UniRef100_P37025
RNA 2',3'-cyclic phosphodiesterase		Shigella sp.		176
RNA 2',3'-cyclic phosphodiesterase		KLEPN		176
RNA 2',3'-cyclic phosphodiesterase		Escherichia coli M8		176
RNA 2',3'-cyclic phosphodiesterase		ECOLX		176
+65

Protein	Similar proteins		Species	Score	Length	Source
P37025	RNA 2',3'-cyclic phosphodiesterase		SHISO		247	UniRef90_P37025
RNA 2',3'-cyclic phosphodiesterase		Shigella sp.		176
RNA 2',3'-cyclic phosphodiesterase		KLEPN		176
RNA 2',3'-cyclic phosphodiesterase		Escherichia coli M8		176
RNA 2',3'-cyclic phosphodiesterase		ECOLX		176
+95

Protein	Similar proteins		Species	Score	Length	Source
P37025	RNA 2',3'-cyclic phosphodiesterase		SHISO		247	UniRef50_P37025
RNA 2',3'-cyclic phosphodiesterase		Shigella sp.		176
RNA 2',3'-cyclic phosphodiesterase		KLEPN		176
RNA 2',3'-cyclic phosphodiesterase		Escherichia coli M8		176
RNA 2',3'-cyclic phosphodiesterase		ECOLX		176
+166

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U00096 Genomic DNA Translation: AAC73258.2 AP009048 Genomic DNA Translation: BAB96724.2 M60726 Genomic DNA No translation available.
PIRⁱ	C64738
RefSeqⁱ	NP_414689.4, NC_000913.3 WP_001294700.1, NZ_LN832404.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	4QAK	X-ray	2.02	A/B	1-176	[»]
ProteinModelPortalⁱ	P37025
SMRⁱ	P37025
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	4259744, 115 interactors
STRINGⁱ	316385.ECDH10B_0127

Proteomic databases

PaxDbⁱ	P37025
PRIDEⁱ	P37025

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAC73258; AAC73258; b0147 BAB96724; BAB96724; BAB96724
GeneIDⁱ	944848
KEGGⁱ	ecj:JW5011 eco:b0147
PATRICⁱ	fig\|1411691.4.peg.2134

Organism-specific databases

EchoBASEⁱ	EB2234
EcoGeneⁱ	EG12330 thpR

Phylogenomic databases

eggNOGⁱ	ENOG4107XID Bacteria COG1514 LUCA
HOGENOMⁱ	HOG000226389
InParanoidⁱ	P37025
KOⁱ	K01975
PhylomeDBⁱ	P37025

Enzyme and pathway databases

BioCycⁱ	EcoCyc:EG12330-MONOMER MetaCyc:EG12330-MONOMER
BRENDAⁱ	6.5.1.B1 2026

Miscellaneous databases

Protein Ontology More...PROⁱ	PR:P37025

PROⁱ

PR:P37025

Family and domain databases

HAMAPⁱ	MF_01940 RNA_CPDase, 1 hit
InterProⁱ	View protein in InterPro IPR009097 cNuc_Pdiesterase IPR014051 Phosphoesterase_HXTX IPR004175 RNA_CPDase
PANTHERⁱ	PTHR35561 PTHR35561, 1 hit
Pfamⁱ	View protein in Pfam PF02834 LigT_PEase, 2 hits
SUPFAMⁱ	SSF55144 SSF55144, 1 hit
TIGRFAMsⁱ	TIGR02258 2_5_ligase, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	THPR_ECOLI
Accessionⁱ	P37025Primary (citable) accession number: P37025 Secondary accession number(s): Q8KJQ1
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	June 1, 1994
	Last sequence update:	January 23, 2007
	Last modified:	November 7, 2018
	This is version 126 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Uncharacterized protein families (UPF)
List of uncharacterized protein family (UPF) entries
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Escherichia coli
Escherichia coli (strain K12): entries and cross-references to EcoGene

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P37025 (THPR_ECOLI)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

RNA 2',3'-cyclic phosphodiesterase

thpR

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

Names & Taxonomyⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ