UniProtKB - P36959 (GMPR1_HUMAN)

BLAST

>sp|P36959|GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens OX=9606 GN=GMPR PE=1 SV=1
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT
FEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
PQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGV
GPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM
LGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD
VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Align
Format
Add to basket Added to basket
History
Entry version 171 (07 Nov 2018)
Sequence version 1 (01 Jun 1994)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

GMP reductase 1

Gene

GMPR

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.UniRule annotation

Caution

The N-terminus was initially (PubMed:2758468) thought to be fused with glucose-6-phosphate-dehydrogenase (G6PD) protein in vivo. However, PubMed:2570640 showed that it encodes a GMP reductase, and PubMed:1694726 showed that the chimeric protein is an artifact.1 Publication

Catalytic activityⁱ

Inosine 5'-phosphate + NH₃ + NADP⁺ = guanosine 5'-phosphate + NADPH.UniRule annotation

Sites

Feature key	Position(s)	DescriptionActions	Length
Binding siteⁱ	78	NADPUniRule annotation	1
Metal bindingⁱ	181	Potassium; via carbonyl oxygenUniRule annotation1 Publication	1
Metal bindingⁱ	183	Potassium; via carbonyl oxygenUniRule annotation1 Publication	1
Active siteⁱ	186	Thioimidate intermediateUniRule annotation	1
Metal bindingⁱ	186	Potassium; via carbonyl oxygenUniRule annotation1 Publication	1
Active siteⁱ	188	Proton donor/acceptorUniRule annotation	1
Metal bindingⁱ	189	PotassiumUniRule annotation1 Publication	1
Binding siteⁱ	269	NADP; via carbonyl oxygenUniRule annotation	1

Regions

Feature key	Position(s)	DescriptionActions	Length
Nucleotide bindingⁱ	26 – 27	NADP; shared with neighboring subunitUniRule annotation	2
Nucleotide bindingⁱ	129 – 131	NADPUniRule annotation	3
Nucleotide bindingⁱ	180 – 181	NADPUniRule annotation	2
Nucleotide bindingⁱ	285 – 286	NADPUniRule annotation	2
Nucleotide bindingⁱ	314 – 317	NADP; shared with neighboring subunitUniRule annotation	4

GO - Molecular functionⁱ

GMP reductase activity
Source: Reactome
Inferred from experimentⁱ
- 12009299
- 218932
metal ion binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

purine-containing compound salvage Source: Reactome
purine nucleobase metabolic process Source: UniProtKB-KW
purine ribonucleotide interconversion
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
response to cold
Source: ProtInc
Traceable author statementⁱ
- 9813009

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Oxidoreductase
Biological process	Purine metabolism
Ligand	Metal-binding, NADP, Potassium

Enzyme and pathway databases

Reactomeⁱ	R-HSA-74217 Purine salvage

Reactomeⁱ

R-HSA-74217 Purine salvage

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: GMP reductase 1UniRule annotation (EC:1.7.1.7UniRule annotation) Short name: GMPR 1UniRule annotation Alternative name(s): Guanosine 5'-monophosphate oxidoreductase 1UniRule annotation Short name: Guanosine monophosphate reductase 1UniRule annotation
Gene namesⁱ	Name:GMPR Synonyms:GMPR1UniRule annotation
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 6

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000137198.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:4376 GMPR
MIMⁱ	139265 gene
neXtProtⁱ	NX_P36959

Subcellular locationⁱ

GO - Cellular component

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	2766
Open Targets More...OpenTargetsⁱ	ENSG00000137198
PharmGKBⁱ	PA28761

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB01972 Guanosine-5'-Monophosphate

DrugBankⁱ

DB01972 Guanosine-5'-Monophosphate

Polymorphism and mutation databases

BioMutaⁱ	GMPR
DMDMⁱ	544455

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000093723	1 – 345	GMP reductase 1Add BLAST		345

Proteomic databases

EPDⁱ	P36959
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P36959
PaxDbⁱ	P36959
PeptideAtlas More...PeptideAtlasⁱ	P36959
PRIDEⁱ	P36959
ProteomicsDBⁱ	55249

PTM databases

iPTMnetⁱ	P36959
PhosphoSitePlusⁱ	P36959

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000137198 Expressed in 183 organ(s), highest expression level in gastrocnemius
CleanExⁱ	HS_GMPR
Genevisibleⁱ	P36959 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA000904 HPA021476

HPAⁱ

HPA000904
HPA021476

Interactionⁱ

Subunit structureⁱ

Homotetramer.UniRule annotation1 Publication

Protein-protein interaction databases

BioGridⁱ	109028, 2 interactors
STRINGⁱ	9606.ENSP00000259727

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	3 – 8	Combined sources	6
Helixⁱ	12 – 14	Combined sources	3
Beta strandⁱ	15 – 17	Combined sources	3
Helixⁱ	27 – 29	Combined sources	3
Beta strandⁱ	34 – 37	Combined sources	4
Turnⁱ	39 – 41	Combined sources	3
Beta strandⁱ	44 – 47	Combined sources	4
Beta strandⁱ	50 – 52	Combined sources	3
Turnⁱ	56 – 58	Combined sources	3
Helixⁱ	61 – 67	Combined sources	7
Helixⁱ	68 – 70	Combined sources	3
Beta strandⁱ	73 – 75	Combined sources	3
Helixⁱ	82 – 91	Combined sources	10
Helixⁱ	93 – 98	Combined sources	6
Beta strandⁱ	99 – 103	Combined sources	5
Helixⁱ	107 – 119	Combined sources	13
Beta strandⁱ	125 – 129	Combined sources	5
Helixⁱ	136 – 148	Combined sources	13
Beta strandⁱ	152 – 159	Combined sources	8
Helixⁱ	162 – 170	Combined sources	9
Beta strandⁱ	174 – 178	Combined sources	5
Helixⁱ	188 – 191	Combined sources	4
Helixⁱ	198 – 210	Combined sources	13
Turnⁱ	211 – 213	Combined sources	3
Beta strandⁱ	215 – 220	Combined sources	6
Helixⁱ	225 – 234	Combined sources	10
Beta strandⁱ	237 – 242	Combined sources	6
Helixⁱ	243 – 245	Combined sources	3
Beta strandⁱ	251 – 253	Combined sources	3
Beta strandⁱ	263 – 267	Combined sources	5
Helixⁱ	272 – 277	Combined sources	6
Beta strandⁱ	285 – 288	Combined sources	4
Beta strandⁱ	292 – 296	Combined sources	5
Helixⁱ	301 – 319	Combined sources	19
Helixⁱ	324 – 326	Combined sources	3
Helixⁱ	327 – 330	Combined sources	4
Beta strandⁱ	333 – 335	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P36959
SMRⁱ	P36959
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P36959

EvolutionaryTraceⁱ

P36959

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	219 – 221	GMP bindingUniRule annotation1 Publication	3
Regionⁱ	242 – 243	GMP bindingUniRule annotation1 Publication	2
Regionⁱ	268 – 270	GMP bindingUniRule annotation1 Publication	3
Regionⁱ	286 – 290	GMP bindingUniRule annotation1 Publication	5

Sequence similaritiesⁱ

Belongs to the IMPDH/GMPR family. GuaC type 1 subfamily.UniRule annotation

Phylogenomic databases

eggNOGⁱ	KOG2550 Eukaryota COG0516 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000062923
HOGENOMⁱ	HOG000165756
HOVERGENⁱ	HBG051744
InParanoidⁱ	P36959
KEGG Orthology (KO) More...KOⁱ	K00364
OMAⁱ	GSHCTTR
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G09KQ
PhylomeDBⁱ	P36959
TreeFamⁱ	TF300378

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00381 IMPDH, 1 hit
Gene3Dⁱ	3.20.20.70, 1 hit
HAMAPⁱ	MF_00596 GMP_reduct_type1, 1 hit
InterProⁱ	View protein in InterPro IPR013785 Aldolase_TIM IPR005993 GMPR IPR015875 IMP_DH/GMP_Rdtase_CS IPR001093 IMP_DH_GMPRt
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00478 IMPDH, 1 hit
PIRSFⁱ	PIRSF000235 GMP_reductase, 1 hit
TIGRFAMsⁱ	TIGR01305 GMP_reduct_1, 1 hit
PROSITEⁱ	View protein in PROSITE PS00487 IMP_DH_GMP_RED, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P36959-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPRIDADLKL DFKDVLLRPK RSSLKSRAEV DLERTFTFRN SKQTYSGIPI 
        60         70         80         90        100
IVANMDTVGT FEMAAVMSQH SMFTAIHKHY SLDDWKLFAT NHPECLQNVA 
       110        120        130        140        150
VSSGSGQNDL EKMTSILEAV PQVKFICLDV ANGYSEHFVE FVKLVRAKFP 
       160        170        180        190        200
EHTIMAGNVV TGEMVEELIL SGADIIKVGV GPGSVCTTRT KTGVGYPQLS 
       210        220        230        240        250
AVIECADSAH GLKGHIISDG GCTCPGDVAK AFGAGADFVM LGGMFSGHTE 
       260        270        280        290        300
CAGEVFERNG RKLKLFYGMS SDTAMNKHAG GVAEYRASEG KTVEVPYKGD 
       310        320        330        340 
VENTILDILG GLRSTCTYVG AAKLKELSRR ATFIRVTQQH NTVFS

Length:345

Mass (Da):37,419

Last modified:June 1, 1994 - v1

Checksum:ⁱ217E1A5A599CA510

Polymorphismⁱ

At least two different alleles are known.

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_003969	234	A → T1 PublicationCorresponds to variant dbSNP:rs760571328Ensembl.		1
Natural variantⁱVAR_003970	256	F → I2 PublicationsCorresponds to variant dbSNP:rs1042391EnsemblClinVar.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L35304 Genomic DNA Translation: AAA52503.1 M27941 Genomic DNA Translation: AAA53106.1 M24470 mRNA Translation: AAA52498.1 AL009031 Genomic DNA No translation available. AL138883 Genomic DNA No translation available. BC008281 mRNA Translation: AAH08281.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS4537.1
PIRⁱ	B32902
NCBI Reference Sequences More...RefSeqⁱ	NP_006868.3, NM_006877.3
UniGeneⁱ	Hs.484741

Genome annotation databases

Ensemblⁱ	ENST00000259727; ENSP00000259727; ENSG00000137198
GeneIDⁱ	2766
KEGGⁱ	hsa:2766
UCSC genome browser More...UCSCⁱ	uc003nbs.3 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Protein	Similar proteins		Species	Score	Length	Source
P36959	GMP reductase 1		RAT		345	UniRef90_P36959
GMP reductase 1		MOUSE		345
GMP reductase		PANTR		345
GMP reductase		GORGO		345
GMP reductase		PANPA		343
+125

Protein	Similar proteins		Species	Score	Length	Source
P36959	GMP reductase 1		RAT		345	UniRef50_P36959
GMP reductase 1		MOUSE		345
GMP reductase		ODORO		345
GMP reductase		SAIBB		345
GMP reductase		Enhydra lutris kenyoni		345
+288

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L35304 Genomic DNA Translation: AAA52503.1 M27941 Genomic DNA Translation: AAA53106.1 M24470 mRNA Translation: AAA52498.1 AL009031 Genomic DNA No translation available. AL138883 Genomic DNA No translation available. BC008281 mRNA Translation: AAH08281.1
CCDSⁱ	CCDS4537.1
PIRⁱ	B32902
RefSeqⁱ	NP_006868.3, NM_006877.3
UniGeneⁱ	Hs.484741

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2BLE	X-ray	1.90	A	1-345	[»]
	2BWG	X-ray	2.40	A/B/C/D	1-345	[»]
ProteinModelPortalⁱ	P36959
SMRⁱ	P36959
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	109028, 2 interactors
STRINGⁱ	9606.ENSP00000259727

Chemistry databases

DrugBankⁱ	DB01972 Guanosine-5'-Monophosphate

DrugBankⁱ

DB01972 Guanosine-5'-Monophosphate

PTM databases

iPTMnetⁱ	P36959
PhosphoSitePlusⁱ	P36959

Polymorphism and mutation databases

BioMutaⁱ	GMPR
DMDMⁱ	544455

Proteomic databases

EPDⁱ	P36959
MaxQBⁱ	P36959
PaxDbⁱ	P36959
PeptideAtlasⁱ	P36959
PRIDEⁱ	P36959
ProteomicsDBⁱ	55249

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	2766
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000259727; ENSP00000259727; ENSG00000137198
GeneIDⁱ	2766
KEGGⁱ	hsa:2766
UCSCⁱ	uc003nbs.3 human

Organism-specific databases

CTDⁱ	2766
DisGeNETⁱ	2766
EuPathDBⁱ	HostDB:ENSG00000137198.9
GeneCardsⁱ	GMPR
HGNCⁱ	HGNC:4376 GMPR
HPAⁱ	HPA000904 HPA021476
MIMⁱ	139265 gene
neXtProtⁱ	NX_P36959
OpenTargetsⁱ	ENSG00000137198
PharmGKBⁱ	PA28761
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2550 Eukaryota COG0516 LUCA
GeneTreeⁱ	ENSGT00530000062923
HOGENOMⁱ	HOG000165756
HOVERGENⁱ	HBG051744
InParanoidⁱ	P36959
KOⁱ	K00364
OMAⁱ	GSHCTTR
OrthoDBⁱ	EOG091G09KQ
PhylomeDBⁱ	P36959
TreeFamⁱ	TF300378

Enzyme and pathway databases

Reactomeⁱ	R-HSA-74217 Purine salvage

Reactomeⁱ

R-HSA-74217 Purine salvage

Miscellaneous databases

ChiTaRSⁱ	GMPR human
EvolutionaryTraceⁱ	P36959
GenomeRNAiⁱ	2766
Protein Ontology More...PROⁱ	PR:P36959
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000137198 Expressed in 183 organ(s), highest expression level in gastrocnemius
CleanExⁱ	HS_GMPR
Genevisibleⁱ	P36959 HS

Family and domain databases

CDDⁱ	cd00381 IMPDH, 1 hit
Gene3Dⁱ	3.20.20.70, 1 hit
HAMAPⁱ	MF_00596 GMP_reduct_type1, 1 hit
InterProⁱ	View protein in InterPro IPR013785 Aldolase_TIM IPR005993 GMPR IPR015875 IMP_DH/GMP_Rdtase_CS IPR001093 IMP_DH_GMPRt
Pfamⁱ	View protein in Pfam PF00478 IMPDH, 1 hit
PIRSFⁱ	PIRSF000235 GMP_reductase, 1 hit
TIGRFAMsⁱ	TIGR01305 GMP_reduct_1, 1 hit
PROSITEⁱ	View protein in PROSITE PS00487 IMP_DH_GMP_RED, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	GMPR1_HUMAN
Accessionⁱ	P36959Primary (citable) accession number: P36959 Secondary accession number(s): Q96HQ6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	June 1, 1994
	Last sequence update:	June 1, 1994
	Last modified:	November 7, 2018
	This is version 171 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 6
Human chromosome 6: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P36959 (GMPR1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

GMP reductase 1

GMPR

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Sites

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Cytosol

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ