Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor necrosis factor receptor superfamily member 3

Gene

LTBR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processApoptosis, Host-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-5668541 TNFR2 non-canonical NF-kB pathway
R-HSA-5676594 TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
SignaLinkiP36941
SIGNORiP36941

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 3
Alternative name(s):
Lymphotoxin-beta receptor
Tumor necrosis factor C receptor
Tumor necrosis factor receptor 2-related protein
Tumor necrosis factor receptor type III
Short name:
TNF-RIII
Short name:
TNFR-III
Gene namesi
Name:LTBR
Synonyms:D12S370, TNFCR, TNFR3, TNFRSF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000111321.10
HGNCiHGNC:6718 LTBR
MIMi600979 gene
neXtProtiNX_P36941

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini31 – 227ExtracellularSequence analysisAdd BLAST197
Transmembranei228 – 248HelicalSequence analysisAdd BLAST21
Topological domaini249 – 435CytoplasmicSequence analysisAdd BLAST187

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4055
OpenTargetsiENSG00000111321
PharmGKBiPA30481

Chemistry databases

ChEMBLiCHEMBL1250360

Polymorphism and mutation databases

DMDMi549090

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30Sequence analysisAdd BLAST30
ChainiPRO_000003455231 – 435Tumor necrosis factor receptor superfamily member 3Add BLAST405

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi40N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi43 ↔ 58PROSITE-ProRule annotation
Disulfide bondi59 ↔ 72PROSITE-ProRule annotation
Disulfide bondi62 ↔ 80PROSITE-ProRule annotation
Disulfide bondi83 ↔ 98PROSITE-ProRule annotation
Disulfide bondi101 ↔ 116PROSITE-ProRule annotation
Disulfide bondi104 ↔ 124PROSITE-ProRule annotation
Disulfide bondi126 ↔ 132PROSITE-ProRule annotation
Disulfide bondi139 ↔ 148PROSITE-ProRule annotation
Disulfide bondi142 ↔ 167PROSITE-ProRule annotation
Disulfide bondi170 ↔ 185PROSITE-ProRule annotation
Glycosylationi177N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei323PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP36941
PaxDbiP36941
PeptideAtlasiP36941
PRIDEiP36941
ProteomicsDBi55239

PTM databases

iPTMnetiP36941
PhosphoSitePlusiP36941

Expressioni

Gene expression databases

BgeeiENSG00000111321 Expressed in 193 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_LTBR
ExpressionAtlasiP36941 baseline and differential
GenevisibleiP36941 HS

Organism-specific databases

HPAiCAB026202
HPA061617

Interactioni

Subunit structurei

Self-associates. Associates with TRAF3, TRAF4 and TRAF5.3 Publications
(Microbial infection) Interacts with HCV core protein.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110233, 79 interactors
CORUMiP36941
DIPiDIP-2928N
ELMiP36941
IntActiP36941, 13 interactors
MINTiP36941
STRINGi9606.ENSP00000228918

Structurei

3D structure databases

ProteinModelPortaliP36941
SMRiP36941
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP36941

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati42 – 81TNFR-Cys 1Add BLAST40
Repeati82 – 124TNFR-Cys 2Add BLAST43
Repeati125 – 168TNFR-Cys 3Add BLAST44
Repeati169 – 211TNFR-Cys 4Add BLAST43

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKNN Eukaryota
ENOG410YQJW LUCA
GeneTreeiENSGT00760000119204
HOGENOMiHOG000294180
HOVERGENiHBG023187
InParanoidiP36941
KOiK03159
OMAiEDGKAWH
OrthoDBiEOG091G03XW
PhylomeDBiP36941
TreeFamiTF331157

Family and domain databases

CDDicd10578 TNFRSF3, 1 hit
InterProiView protein in InterPro
IPR001368 TNFR/NGFR_Cys_rich_reg
IPR017349 TNFR_3_LTBR
IPR033997 TNFRSF3_N
PfamiView protein in Pfam
PF00020 TNFR_c6, 3 hits
PIRSFiPIRSF037999 TNFR_3_LTBR, 1 hit
PRINTSiPR01920 TNFACTORR3
SMARTiView protein in SMART
SM00208 TNFR, 4 hits
PROSITEiView protein in PROSITE
PS00652 TNFR_NGFR_1, 2 hits
PS50050 TNFR_NGFR_2, 3 hits

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: P36941-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLLPWATSAP GLAWGPLVLG LFGLLAASQP QAVPPYASEN QTCRDQEKEY
60 70 80 90 100
YEPQHRICCS RCPPGTYVSA KCSRIRDTVC ATCAENSYNE HWNYLTICQL
110 120 130 140 150
CRPCDPVMGL EEIAPCTSKR KTQCRCQPGM FCAAWALECT HCELLSDCPP
160 170 180 190 200
GTEAELKDEV GKGNNHCVPC KAGHFQNTSS PSARCQPHTR CENQGLVEAA
210 220 230 240 250
PGTAQSDTTC KNPLEPLPPE MSGTMLMLAV LLPLAFFLLL ATVFSCIWKS
260 270 280 290 300
HPSLCRKLGS LLKRRPQGEG PNPVAGSWEP PKAHPYFPDL VQPLLPISGD
310 320 330 340 350
VSPVSTGLPA APVLEAGVPQ QQSPLDLTRE PQLEPGEQSQ VAHGTNGIHV
360 370 380 390 400
TGGSMTITGN IYIYNGPVLG GPPGPGDLPA TPEPPYPIPE EGDPGPPGLS
410 420 430
TPHQEDGKAW HLAETEHCGA TPSNRGPRNQ FITHD
Length:435
Mass (Da):46,709
Last modified:June 1, 1994 - v1
Checksum:i624626E6022F656F
GO
Isoform 2 (identifier: P36941-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MLLPWATSAPGLAWGPLVLGLFGLLAASQPQA → MEATGISLASQLK

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):44,810
Checksum:i43DF8C86945A0F3E
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H6F8F5H6F8_HUMAN
Tumor necrosis factor receptor supe...
LTBR
217Annotation score:
F5H2E7F5H2E7_HUMAN
Tumor necrosis factor receptor supe...
LTBR
292Annotation score:
F5H627F5H627_HUMAN
Tumor necrosis factor receptor supe...
LTBR
148Annotation score:
F5H1S5F5H1S5_HUMAN
Tumor necrosis factor receptor supe...
LTBR
74Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti76R → W in BAH11468 (PubMed:14702039).Curated1
Sequence conflicti410W → R in BAH11468 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052346274V → I. Corresponds to variant dbSNP:rs35681405Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0475331 – 32MLLPW…SQPQA → MEATGISLASQLK in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04270 mRNA Translation: AAA36757.1
AK293187 mRNA Translation: BAH11468.1
AC005840 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88801.1
CH471116 Genomic DNA Translation: EAW88802.1
BC026262 mRNA Translation: AAH26262.1
CCDSiCCDS59233.1 [P36941-2]
CCDS8544.1 [P36941-1]
PIRiI54182
RefSeqiNP_001257916.1, NM_001270987.1 [P36941-2]
NP_002333.1, NM_002342.2 [P36941-1]
UniGeneiHs.1116

Genome annotation databases

EnsembliENST00000228918; ENSP00000228918; ENSG00000111321 [P36941-1]
ENST00000539925; ENSP00000440875; ENSG00000111321 [P36941-2]
GeneIDi4055
KEGGihsa:4055
UCSCiuc001qny.3 human [P36941-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTNR3_HUMAN
AccessioniPrimary (citable) accession number: P36941
Secondary accession number(s): B7Z1D2, D3DUR2, F5GXE7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: September 12, 2018
This is version 175 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again