Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P36406 (TRI23_HUMAN)

Entry version 202 (07 Apr 2021)
Sequence version 1 (01 Jun 1994)
Previous versions | rss
Add a publicationFeedback
Protein

E3 ubiquitin-protein ligase TRIM23

Gene

TRIM23

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as an E3 ubiquitin-protein ligase. Plays an essential role in autophagy activation during viral infection. Mechanistically, activates TANK-binding kinase 1/TBK1 by facilitating its dimerization and ability to phosphorylate the selective autophagy receptor SQSTM1. In order to achieve this function, TRIM23 mediates 'Lys-27'-linked auto-ubiquitination of its ADP-ribosylation factor (ARF) domain to induce its GTPase activity and its recruitment to autophagosomes (PubMed:28871090).2 Publications
(Microbial infection) Mediates TRAF6 auto-ubiquitination in the presence of human cytomegalovirus protein UL144, resulting in the virally controlled activation of NF-kappa-B stimulation at early times of HCMV infection.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri31 – 76RING-type; degeneratePROSITE-ProRule annotationAdd BLAST46
Zinc fingeri122 – 168B box-type; degeneratePROSITE-ProRule annotationAdd BLAST47
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi411 – 418GTPBy similarity8
Nucleotide bindingi454 – 458GTPBy similarity5
Nucleotide bindingi513 – 516GTPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processHost-virus interaction, Immunity, Innate immunity, Ubl conjugation pathway
LigandGTP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P36406

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM23 (EC:2.3.2.27)
Alternative name(s):
ADP-ribosylation factor domain-containing protein 1
GTP-binding protein ARD-1
RING finger protein 46
RING-type E3 ubiquitin transferase TRIM23Curated
Tripartite motif-containing protein 23
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRIM23
Synonyms:ARD1, ARFD1, RNF46
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:660, TRIM23

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601747, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P36406

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000113595.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Golgi apparatus, Lysosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi34C → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication1
Mutagenesisi53H → A: Loss of E3 ubiquitin-protein ligase activity. 1 Publication1
Mutagenesisi418T → N: Maintains GTPase activity. Increases interaction with PSCD1. 1 Publication1
Mutagenesisi458K → I: Suppresses GTPase activity. Decreases interaction with PSCD1. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		373

Open Targets

More...OpenTargetsi		ENSG00000113595

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24943

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P36406, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TRIM23

Domain mapping of disease mutations (DMDM)

More...DMDMi		543839

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002074831 – 574E3 ubiquitin-protein ligase TRIM23Add BLAST574

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P36406

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P36406

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P36406

MaxQB - The MaxQuant DataBase

More...MaxQBi		P36406

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P36406

PeptideAtlas

More...PeptideAtlasi		P36406

PRoteomics IDEntifications database

More...PRIDEi		P36406

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55200 [P36406-1]
55201 [P36406-2]
55202 [P36406-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P36406

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P36406

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000113595, Expressed in corpus callosum and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P36406, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P36406, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000113595, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with PSCD1.

Interacts with UBE2D2 (PubMed:28681414).

Interacts with TBK1 (via N-terminal kinase domain) and p62/SQSTM1.

3 Publications

(Microbial infection) Interacts with human cytomegalovirus protein UL144; this interaction might cause autoubiquitination of TRAF6, leading to NF-kappa-B activation.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

P36406
With#Exp.IntAct
ACTN4 [A0A0S2Z3G1]3EBI-740098,EBI-16430749
ANKRD36BP1 [Q96IX9]3EBI-740098,EBI-744859
ANKRD55 [Q3KP44]3EBI-740098,EBI-14493093
AP3M1 [Q9Y2T2]3EBI-740098,EBI-2371151
AQP1 [P29972]6EBI-740098,EBI-745213
ARFGAP1 [Q8N6T3]3EBI-740098,EBI-716933
ARHGEF3 [Q9NR81]5EBI-740098,EBI-10312733
ATPAF2 [Q8N5M1]7EBI-740098,EBI-1166928
ATXN1 [P54253]6EBI-740098,EBI-930964
BAG1 [Q99933]5EBI-740098,EBI-1030678
BICRAL [Q6AI39]3EBI-740098,EBI-1012434
BRME1 [Q0VDD7]4EBI-740098,EBI-741210
C2CD6 [Q53TS8]3EBI-740098,EBI-739879
C8orf33 [Q9H7E9]3EBI-740098,EBI-715389
CARD9 [Q9H257]4EBI-740098,EBI-751319
CASP6 [P55212]3EBI-740098,EBI-718729
CBX8 [Q9HC52]3EBI-740098,EBI-712912
CCDC13 [Q8IYE1]3EBI-740098,EBI-10961312
CCDC146 - isoform 2 [Q8IYE0-2]3EBI-740098,EBI-10247802
CCDC25 [Q86WR0]3EBI-740098,EBI-2690264
CDC20B [Q86Y33]3EBI-740098,EBI-10260504
CDC73 [Q6P1J9]3EBI-740098,EBI-930143
CDR2 [Q01850]6EBI-740098,EBI-1181367
CFAP53 [Q96M91]3EBI-740098,EBI-742422
COX5B [P10606]5EBI-740098,EBI-1053725
CPNE7 - isoform 2 [Q9UBL6-2]3EBI-740098,EBI-12012272
CREB5 - isoform 3 [Q02930-3]3EBI-740098,EBI-10192698
CSRP2 [Q16527]3EBI-740098,EBI-2959737
CWF19L2 [Q2TBE0]3EBI-740098,EBI-5453285
CXCL14 [O95715]3EBI-740098,EBI-2798068
DCX [O43602]3EBI-740098,EBI-8646694
DMC1 [Q14565]3EBI-740098,EBI-930865
DMRT3 [Q9NQL9]3EBI-740098,EBI-9679045
DOCK2 [Q92608]3EBI-740098,EBI-448771
EAF2 [Q96CJ1]3EBI-740098,EBI-1245604
EHHADH [Q08426]3EBI-740098,EBI-2339219
EIF3D [O15371]3EBI-740098,EBI-353818
ENKD1 [Q9H0I2]3EBI-740098,EBI-744099
EPN2 - isoform 2 [O95208-2]3EBI-740098,EBI-12135243
EXOC3-AS1 [Q8N2X6]3EBI-740098,EBI-749333
FAM110A [Q9BQ89]6EBI-740098,EBI-1752811
FAM133A [Q8N9E0]6EBI-740098,EBI-10268158
FAM193B - isoform 2 [Q96PV7-2]3EBI-740098,EBI-10292648
FAM83A [Q86UY5]3EBI-740098,EBI-1384254
FAM90A1 [Q86YD7]6EBI-740098,EBI-6658203
FBF1 - isoform 6 [Q8TES7-6]3EBI-740098,EBI-10244131
FGFR3 [P22607]3EBI-740098,EBI-348399
FLAD1 - isoform 2 [Q8NFF5-2]3EBI-740098,EBI-11526128
FLJ38668 [C0H5X2]3EBI-740098,EBI-10176227
GAD1 [A0A0S2Z4D9]3EBI-740098,EBI-16430771
GATA2 [P23769]4EBI-740098,EBI-2806671
GEM [P55040]7EBI-740098,EBI-744104
GGA3 - isoform Short [Q9NZ52-2]3EBI-740098,EBI-12075758
GMCL2 [Q8NEA9]3EBI-740098,EBI-745707
GPANK1 [O95872]7EBI-740098,EBI-751540
GPKOW [Q92917]4EBI-740098,EBI-746309
GRIN2C [Q14957]3EBI-740098,EBI-8285963
GSN [P06396]3EBI-740098,EBI-351506
HAPLN2 [Q9GZV7]3EBI-740098,EBI-11956675
HAUS1 [Q96CS2]3EBI-740098,EBI-2514791
HGS [O14964]3EBI-740098,EBI-740220
HIP1 [O00291]3EBI-740098,EBI-473886
HOXB5 [P09067]6EBI-740098,EBI-3893317
HRAS [P01112]3EBI-740098,EBI-350145
HSPB1 [P04792]3EBI-740098,EBI-352682
HSPB7 [Q9UBY9]3EBI-740098,EBI-739361
IL16 - isoform 2 [Q14005-2]3EBI-740098,EBI-17178971
IQUB [Q8NA54]7EBI-740098,EBI-10220600
JOSD1 [Q15040]3EBI-740098,EBI-2510602
JRK - isoform 2 [O75564-2]3EBI-740098,EBI-17181882
KAT5 [Q92993]3EBI-740098,EBI-399080
KIF1B - isoform 2 [O60333-2]3EBI-740098,EBI-10975473
KIFC3 [Q9BVG8]3EBI-740098,EBI-2125614
KLHL42 [Q9P2K6]6EBI-740098,EBI-739890
KRT6A [P02538]8EBI-740098,EBI-702198
KRT75 [O95678]3EBI-740098,EBI-2949715
KRT76 [Q01546]3EBI-740098,EBI-2952745
LAGE3 [Q14657]3EBI-740098,EBI-1052105
LAMP2 - isoform LAMP-2B [P13473-2]3EBI-740098,EBI-21591415
LENG1 [Q96BZ8]3EBI-740098,EBI-726510
LGALS14 [Q8TCE9]3EBI-740098,EBI-10274069
LGALS8 [O00214]4EBI-740098,EBI-740058
LINC00526 [Q96FQ7]3EBI-740098,EBI-10286106
LMO2 [P25791]3EBI-740098,EBI-739696
LMO3 - isoform 4 [Q8TAP4-4]3EBI-740098,EBI-11742507
LNX1 [Q8TBB1]3EBI-740098,EBI-739832
MORN4 [Q8NDC4]6EBI-740098,EBI-10269566
MRPL4 [Q9BYD3]3EBI-740098,EBI-721368
MRPL45 [Q9BRJ2]3EBI-740098,EBI-2514313
MSRB3 - isoform 2 [Q8IXL7-2]3EBI-740098,EBI-10699187
MTFR2 [Q6P444]3EBI-740098,EBI-10252703
MYEF2 - isoform 2 [Q9P2K5-2]3EBI-740098,EBI-10318831
MYOM1 - isoform 2 [P52179-2]3EBI-740098,EBI-12010196
MYOZ1 [Q9NP98]3EBI-740098,EBI-744402
NAB2 [Q15742]3EBI-740098,EBI-8641936
NEDD9 - isoform 2 [Q14511-2]3EBI-740098,EBI-11746523
NEK6 [Q9HC98]4EBI-740098,EBI-740364
NFU1 [Q9UMS0]3EBI-740098,EBI-725252
NOXA1 - isoform 2 [Q86UR1-2]3EBI-740098,EBI-12025760
NTAQ1 [Q96HA8]3EBI-740098,EBI-741158
NUDT21 [O43809]3EBI-740098,EBI-355720
NXT2 [Q9NPJ8]3EBI-740098,EBI-752122
PHF1 [O43189]4EBI-740098,EBI-530034
PIAS2 [O75928]3EBI-740098,EBI-348555
PIK3R2 [O00459]3EBI-740098,EBI-346930
PITX1 [P78337]4EBI-740098,EBI-748265
PKP4 [Q99569]3EBI-740098,EBI-726447
PLEKHA2 [Q9HB19]3EBI-740098,EBI-4401947
POLL - isoform 2 [Q9UGP5-2]3EBI-740098,EBI-10320765
POM121 - isoform 2 [Q96HA1-2]3EBI-740098,EBI-11956563
PPIL2 [Q13356]3EBI-740098,EBI-7705988
PPP1R15B [Q5SWA1]3EBI-740098,EBI-2815482
PPP1R18 [Q6NYC8]3EBI-740098,EBI-2557469
PRPF18 [Q99633]3EBI-740098,EBI-2798416
PRPF31 [Q8WWY3]3EBI-740098,EBI-1567797
PSMA1 [P25786]5EBI-740098,EBI-359352
PSMB1 [P20618]3EBI-740098,EBI-372273
RAMAC [Q9BTL3]6EBI-740098,EBI-744023
RAN [P62826]3EBI-740098,EBI-286642
RCAN3 [Q9UKA8]3EBI-740098,EBI-9091952
RIBC1 [Q8N443]3EBI-740098,EBI-10265323
RIN1 [Q13671]3EBI-740098,EBI-366017
RNF213 - isoform 4 [Q63HN8-6]3EBI-740098,EBI-10248548
RNF6 [A0A0S2Z4G9]3EBI-740098,EBI-16428950
RSRC2 - isoform 2 [Q7L4I2-2]3EBI-740098,EBI-10256202
RTP5 [Q14D33]3EBI-740098,EBI-10217913
RUFY1 - isoform 2 [Q96T51-2]3EBI-740098,EBI-12192715
SCNM1 [Q9BWG6]3EBI-740098,EBI-748391
SH2D4A [Q9H788]3EBI-740098,EBI-747035
SH2D4A - isoform 2 [Q9H788-2]3EBI-740098,EBI-10308083
SIAH1 [Q8IUQ4]3EBI-740098,EBI-747107
SLC25A6 [P12236]3EBI-740098,EBI-356254
SMG9 [Q9H0W8]6EBI-740098,EBI-2872322
SNAI1 [O95863]7EBI-740098,EBI-1045459
SNAI2 [O43623]3EBI-740098,EBI-9876238
SNRPB - isoform SM-B [P14678-2]3EBI-740098,EBI-372475
SNRPB2 [P08579]3EBI-740098,EBI-1053651
SNW1 [Q13573]3EBI-740098,EBI-632715
SORBS3 [O60504]6EBI-740098,EBI-741237
SPG21 [Q9NZD8]3EBI-740098,EBI-742688
STK19 [B7ZLI8]3EBI-740098,EBI-10176124
SUMO1P1 [G2XKQ0]3EBI-740098,EBI-10175576
TACO1 [Q9BSH4]3EBI-740098,EBI-747797
TARDBP [Q13148]3EBI-740098,EBI-372899
TASOR2 - isoform 2 [Q5VWN6-2]3EBI-740098,EBI-10172380
TBC1D22B [Q9NU19]8EBI-740098,EBI-8787464
TCEA2 [Q15560]3EBI-740098,EBI-710310
TCEANC - isoform 2 [Q8N8B7-2]3EBI-740098,EBI-11955057
TEPSIN [Q96N21]3EBI-740098,EBI-11139477
TEX33 - isoform 2 [O43247-2]3EBI-740098,EBI-12093053
TMSB4X [Q0P5Q0]3EBI-740098,EBI-10226570
TNFAIP3 [P21580]6EBI-740098,EBI-527670
TRAF1 [Q13077]3EBI-740098,EBI-359224
itself7EBI-740098,EBI-740098
TRIM29 [Q0P6H7]3EBI-740098,EBI-10226710
TRIM29 [Q14134]4EBI-740098,EBI-702370
TRIM42 [Q8IWZ5]3EBI-740098,EBI-5235829
TRIM55 [Q9BYV6]2EBI-740098,EBI-2341179
TROAP [Q12815]5EBI-740098,EBI-2349743
TSEN54 [Q7Z6J9]3EBI-740098,EBI-2559824
TSHZ3 [Q63HK5]3EBI-740098,EBI-9053916
TXNDC5 [Q86UY0]3EBI-740098,EBI-2825190
UBE2I [Q7KZS0]3EBI-740098,EBI-10180829
UBQLN1 [Q9UMX0]6EBI-740098,EBI-741480
USP2 [O75604]3EBI-740098,EBI-743272
USP20 [Q9Y2K6]3EBI-740098,EBI-2511991
UTP23 [Q9BRU9]3EBI-740098,EBI-5457544
VGLL1 [Q99990]3EBI-740098,EBI-11983165
WDR25 [Q64LD2]3EBI-740098,EBI-744560
WFS1 [O76024]3EBI-740098,EBI-720609
ZBTB16 [Q05516]3EBI-740098,EBI-711925
ZBTB4 [Q9P1Z0]3EBI-740098,EBI-2564133
ZC2HC1C [Q53FD0]3EBI-740098,EBI-740767
ZC2HC1C - isoform 2 [Q53FD0-2]3EBI-740098,EBI-14104088
ZFAND2A [Q8N6M9]3EBI-740098,EBI-3921109
ZNF20 [P17024]3EBI-740098,EBI-717634
ZNF250 - isoform 3 [P15622-3]3EBI-740098,EBI-10177272
ZNF408 [Q9H9D4]3EBI-740098,EBI-347633
ZNF417 [Q8TAU3]3EBI-740098,EBI-740727
ZNF474 [Q6S9Z5]3EBI-740098,EBI-17269964
ZNF564 [Q8TBZ8]6EBI-740098,EBI-10273713
ZNF581 [Q9P0T4]8EBI-740098,EBI-745520
ZNF587 [Q96SQ5]3EBI-740098,EBI-6427977
ZNF688 [A0A0S2Z5X4]3EBI-740098,EBI-16429014
ZNF688 [A0A0S2Z6P0]3EBI-740098,EBI-16429989
ZNF835 [Q9Y2P0]3EBI-740098,EBI-5667516
Hoxa1 [P09022] from Mus musculus.2EBI-740098,EBI-3957603

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		106868, 237 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P36406

Protein interaction database and analysis system

More...IntActi		P36406, 231 interactors

Molecular INTeraction database

More...MINTi		P36406

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000231524

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P36406, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1574
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P36406

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni390 – 574ARF-likeAdd BLAST185

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili352 – 379Sequence analysisAdd BLAST28

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING-type zinc finger domain is responsible for E3 ubiquitin ligase activity. This domain is catalytically active as a dimer.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

In the C-terminal section; belongs to the small GTPase superfamily. Arf family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri31 – 76RING-type; degeneratePROSITE-ProRule annotationAdd BLAST46
Zinc fingeri122 – 168B box-type; degeneratePROSITE-ProRule annotationAdd BLAST47

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0070, Eukaryota
KOG4185, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158562

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_033905_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P36406

Identification of Orthologs from Complete Genome Data

More...OMAi		WHIQGSS

Database of Orthologous Groups

More...OrthoDBi		1362554at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P36406

TreeFam database of animal gene trees

More...TreeFami		TF320703

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003649, Bbox_C
IPR027417, P-loop_NTPase
IPR005225, Small_GTP-bd_dom
IPR006689, Small_GTPase_ARF/SAR
IPR000315, Znf_B-box
IPR013087, Znf_C2H2_type
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00025, Arf, 1 hit
PF00643, zf-B_box, 1 hit
PF14634, zf-RING_5, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00328, SAR1GTPBP

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00502, BBC, 1 hit
SM00336, BBOX, 2 hits
SM00184, RING, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540, SSF52540, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00231, small_GTP, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51417, ARF, 1 hit
PS50119, ZF_BBOX, 1 hit
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: P36406-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATLVVNKLG AGVDSGRQGS RGTAVVKVLE CGVCEDVFSL QGDKVPRLLL 
        60         70         80         90        100
CGHTVCHDCL TRLPLHGRAI RCPFDRQVTD LGDSGVWGLK KNFALLELLE 
       110        120        130        140        150
RLQNGPIGQY GAAEESIGIS GESIIRCDED EAHLASVYCT VCATHLCSEC 
       160        170        180        190        200
SQVTHSTKTL AKHRRVPLAD KPHEKTMCSQ HQVHAIEFVC LEEGCQTSPL 
       210        220        230        240        250
MCCVCKEYGK HQGHKHSVLE PEANQIRASI LDMAHCIRTF TEEISDYSRK 
       260        270        280        290        300
LVGIVQHIEG GEQIVEDGIG MAHTEHVPGT AENARSCIRA YFYDLHETLC 
       310        320        330        340        350
RQEEMALSVV DAHVREKLIW LRQQQEDMTI LLSEVSAACL HCEKTLQQDD 
       360        370        380        390        400
CRVVLAKQEI TRLLETLQKQ QQQFTEVADH IQLDASIPVT FTKDNRVHIG 
       410        420        430        440        450
PKMEIRVVTL GLDGAGKTTI LFKLKQDEFM QPIPTIGFNV ETVEYKNLKF 
       460        470        480        490        500
TIWDVGGKHK LRPLWKHYYL NTQAVVFVVD SSHRDRISEA HSELAKLLTE 
       510        520        530        540        550
KELRDALLLI FANKQDVAGA LSVEEITELL SLHKLCCGRS WYIQGCDARS 
       560        570 
GMGLYEGLDW LSRQLVAAGV LDVA
Length:574
Mass (Da):64,067
Last modified:June 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCB85923B29BF0320
GO
Isoform Beta (identifier: P36406-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     551-574: GMGLYEGLDWLSRQLVAAGVLDVA → VFQIICDQYTGKEVVTEKG

Show »
Length:569
Mass (Da):63,690
Checksum:i21399953A4224B7A
GO
Isoform Gamma (identifier: P36406-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     541-574: WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA → CFSDNM

Show »
Length:546
Mass (Da):61,068
Checksum:iD21D92EED6E967A2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBN4D6RBN4_HUMAN
E3 ubiquitin-protein ligase TRIM23
TRIM23
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9E9D6R9E9_HUMAN
E3 ubiquitin-protein ligase TRIM23
TRIM23
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD22D6RD22_HUMAN
E3 ubiquitin-protein ligase TRIM23
TRIM23
34Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048320480D → N. Corresponds to variant dbSNP:rs34046496Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000297541 – 574WYIQG…VLDVA → CFSDNM in isoform Gamma. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_000296551 – 574GMGLY…VLDVA → VFQIICDQYTGKEVVTEKG in isoform Beta. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L04510 mRNA Translation: AAA35940.1
AF230397 mRNA Translation: AAG50176.1
AF230398 mRNA Translation: AAG50177.1
AF230399 mRNA Translation: AAG50178.1
BC022510 mRNA Translation: AAH22510.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3986.1 [P36406-3]
CCDS3987.1 [P36406-1]
CCDS43322.1 [P36406-2]

Protein sequence database of the Protein Information Resource

More...PIRi		A46054

NCBI Reference Sequences

More...RefSeqi		NP_001647.1, NM_001656.3 [P36406-1]
NP_150230.1, NM_033227.2 [P36406-2]
NP_150231.1, NM_033228.2 [P36406-3]
XP_016864933.1, XM_017009444.1 [P36406-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000231524; ENSP00000231524; ENSG00000113595 [P36406-1]
ENST00000274327; ENSP00000274327; ENSG00000113595 [P36406-3]
ENST00000381018; ENSP00000370406; ENSG00000113595 [P36406-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		373

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:373

UCSC genome browser

More...UCSCi		uc003jtw.4, human [P36406-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04510 mRNA Translation: AAA35940.1
AF230397 mRNA Translation: AAG50176.1
AF230398 mRNA Translation: AAG50177.1
AF230399 mRNA Translation: AAG50178.1
BC022510 mRNA Translation: AAH22510.1
CCDSiCCDS3986.1 [P36406-3]
CCDS3987.1 [P36406-1]
CCDS43322.1 [P36406-2]
PIRiA46054
RefSeqiNP_001647.1, NM_001656.3 [P36406-1]
NP_150230.1, NM_033227.2 [P36406-2]
NP_150231.1, NM_033228.2 [P36406-3]
XP_016864933.1, XM_017009444.1 [P36406-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5VZVX-ray1.81A/B/C1-123[»]
5VZWX-ray2.28F/G1-123[»]
SMRiP36406
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi106868, 237 interactors
CORUMiP36406
IntActiP36406, 231 interactors
MINTiP36406
STRINGi9606.ENSP00000231524

PTM databases

iPTMnetiP36406
PhosphoSitePlusiP36406

Genetic variation databases

BioMutaiTRIM23
DMDMi543839

Proteomic databases

EPDiP36406
jPOSTiP36406
MassIVEiP36406
MaxQBiP36406
PaxDbiP36406
PeptideAtlasiP36406
PRIDEiP36406
ProteomicsDBi55200 [P36406-1]
55201 [P36406-2]
55202 [P36406-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		11584, 256 antibodies

The DNASU plasmid repository

More...DNASUi		373

Genome annotation databases

EnsembliENST00000231524; ENSP00000231524; ENSG00000113595 [P36406-1]
ENST00000274327; ENSP00000274327; ENSG00000113595 [P36406-3]
ENST00000381018; ENSP00000370406; ENSG00000113595 [P36406-2]
GeneIDi373
KEGGihsa:373
UCSCiuc003jtw.4, human [P36406-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		373
DisGeNETi373

GeneCards: human genes, protein and diseases

More...GeneCardsi		TRIM23
HGNCiHGNC:660, TRIM23
HPAiENSG00000113595, Low tissue specificity
MIMi601747, gene
neXtProtiNX_P36406
OpenTargetsiENSG00000113595
PharmGKBiPA24943
VEuPathDBiHostDB:ENSG00000113595.14

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0070, Eukaryota
KOG4185, Eukaryota
GeneTreeiENSGT00940000158562
HOGENOMiCLU_033905_0_0_1
InParanoidiP36406
OMAiWHIQGSS
OrthoDBi1362554at2759
PhylomeDBiP36406
TreeFamiTF320703

Enzyme and pathway databases

UniPathwayiUPA00143
PathwayCommonsiP36406

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		373, 11 hits in 999 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TRIM23

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		373
PharosiP36406, Tbio

Protein Ontology

More...PROi		PR:P36406
RNActiP36406, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000113595, Expressed in corpus callosum and 225 other tissues
ExpressionAtlasiP36406, baseline and differential
GenevisibleiP36406, HS

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR003649, Bbox_C
IPR027417, P-loop_NTPase
IPR005225, Small_GTP-bd_dom
IPR006689, Small_GTPase_ARF/SAR
IPR000315, Znf_B-box
IPR013087, Znf_C2H2_type
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS
PfamiView protein in Pfam
PF00025, Arf, 1 hit
PF00643, zf-B_box, 1 hit
PF14634, zf-RING_5, 1 hit
PRINTSiPR00328, SAR1GTPBP
SMARTiView protein in SMART
SM00502, BBC, 1 hit
SM00336, BBOX, 2 hits
SM00184, RING, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit
TIGRFAMsiTIGR00231, small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51417, ARF, 1 hit
PS50119, ZF_BBOX, 1 hit
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRI23_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P36406
Secondary accession number(s): Q9BZY4, Q9BZY5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: April 7, 2021
This is version 202 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again