Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 117 (10 Feb 2021)
Sequence version 1 (01 Jun 1994)
Previous versions | rss
Add a publicationFeedback
Protein

Microtubule-associated protein 4

Gene

MAP4

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Non-neuronal microtubule-associated protein. Promotes microtubule assembly.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • microtubule binding Source: GO_Central

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule-associated protein 4
Short name:
MAP-4
Alternative name(s):
Microtubule-associated protein U
Short name:
MAP-U
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAP4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiBos taurus (Bovine)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9913 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaArtiodactylaRuminantiaPecoraBovidaeBovinaeBos
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000009136 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000727502 – 1072Microtubule-associated protein 4Add BLAST1071

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei5PhosphoserineBy similarity1
Modified residuei14PhosphoserineBy similarity1
Modified residuei60PhosphoserineBy similarity1
Modified residuei253PhosphoserineBy similarity1
Modified residuei280PhosphoserineBy similarity1
Modified residuei282PhosphothreonineBy similarity1
Modified residuei354PhosphothreonineBy similarity1
Modified residuei386PhosphoserineBy similarity1
Modified residuei414PhosphoserineBy similarity1
Modified residuei416PhosphothreonineBy similarity1
Modified residuei501PhosphothreonineBy similarity1
Modified residuei529PhosphoserineBy similarity1
Modified residuei572PhosphoserineBy similarity1
Modified residuei584PhosphoserineBy similarity1
Modified residuei591PhosphoserineBy similarity1
Modified residuei643PhosphoserineBy similarity1
Modified residuei660PhosphoserineBy similarity1
Modified residuei670PhosphoserineBy similarity1
Modified residuei734PhosphoserineBy similarity1
Modified residuei774PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki785Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei800PhosphoserineBy similarity1
Modified residuei874PhosphoserineBy similarity1
Modified residuei887Phosphoserine; by MARK1By similarity1
Modified residuei888PhosphothreonineBy similarity1
Modified residuei988PhosphoserineBy similarity1
Modified residuei1060PhosphoserineBy similarity1
Modified residuei1066PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly (By similarity). Phosphorylation on Ser-734 negatively regulates MAP4 activity to promote microtubule assembly.By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P36225

PeptideAtlas

More...
PeptideAtlasi
P36225

PRoteomics IDEntifications database

More...
PRIDEi
P36225

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P36225

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Is distributed ubiquitously among all tissues but amounts are lower in cerebellum and liver.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SEPTIN2; this interaction impedes tubulin-binding (By similarity).

Interacts with TRAF3IP1 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9913.ENSBTAP00000021045

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
P36225

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P36225

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati244 – 2571Add BLAST14
Repeati258 – 2712Add BLAST14
Repeati272 – 2853Add BLAST14
Repeati286 – 2994Add BLAST14
Repeati300 – 3135Add BLAST14
Repeati314 – 3276Add BLAST14
Repeati328 – 3417Add BLAST14
Repeati342 – 3558Add BLAST14
Repeati384 – 3919; truncated8
Repeati392 – 40510Add BLAST14
Repeati406 – 41711Add BLAST12
Repeati418 – 43112Add BLAST14
Repeati432 – 44513Add BLAST14
Repeati446 – 46014Add BLAST15
Repeati461 – 47415Add BLAST14
Repeati475 – 48816Add BLAST14
Repeati489 – 50217Add BLAST14
Repeati503 – 51618Add BLAST14
Repeati517 – 53019Add BLAST14
Repeati869 – 899Tau/MAP 1Add BLAST31
Repeati938 – 968Tau/MAP 2Add BLAST31
Repeati969 – 1000Tau/MAP 3Add BLAST32

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni244 – 53019 X 14 AA tandem repeatsAdd BLAST287

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2418, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P36225

Database of Orthologous Groups

More...
OrthoDBi
716848at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027323, MAP4
IPR001084, MAP_tubulin-bd_rpt

The PANTHER Classification System

More...
PANTHERi
PTHR11501:SF16, PTHR11501:SF16, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00418, Tubulin-binding, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00229, TAU_MAP_1, 3 hits
PS51491, TAU_MAP_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P36225-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADLSLADAL TEPSPEIEEE IKRDFIATLE AEAFDDVVGE TVGKTDYIPL
60 70 80 90 100
LDVDEKTGSS ESKKKPCSDT SQVEGTPSSQ AAVLANGDHG IERNDVTGFP
110 120 130 140 150
SEFLEEKMAY QGYQNSQNWP ENTNFCFEPE HMVNPIQTDP FKMHHDDGLE
160 170 180 190 200
DSLFFPSGTT NTSVFVEQND PLKDTYGMLP CDTFAPAAVV PQGWSAEAPN
210 220 230 240 250
LAHLESFTSP EAVPQPLQPT AEPAEKVEMA SGEERAEALE MMMKLQAADM
260 270 280 290 300
APSREAEMVL AKDVVPATET GVALAKDMES PTKPDEALVK DVESSIESDM
310 320 330 340 350
ALVKDVVLPV QTEETAVKDA ILPTETDVSL DEDLALSTET EVSTAQDILL
360 370 380 390 400
FKETESIPPV TMDLASAEGT VPPTDQEMTP VKVAASLSEI EAPLDEDIVS
410 420 430 440 450
STEIRSAKEI GLSSETEVAL SREMGLPPET EAILDKDMAA PPETEVIVPV
460 470 480 490 500
KDMAPSPGIE TTLAKDVAPR QEIEVTLGKD TVSLPATEMA LGRNVALPPE
510 520 530 540 550
TEVTLAKDVA QPPETEVNLA NNAALAKFSE AEVVPVPVKD METAQTQEAT
560 570 580 590 600
SEDSQLKSLQ DEGQSAVPLM TSPEAVVAMG QKHSLPTDED SVLEELEQKK
610 620 630 640 650
PSSQTSELPS ETSGVAKPEE GPPTGSVSGN DITAPPNKEL PPSPEKKTKP
660 670 680 690 700
LATTQPAKTS TSKAKTQPTS LPKQTAPTTL GGSNKKPMSL ASGSVPAAPP
710 720 730 740 750
KRPAAATSRP STLPSKDTKP KPVAEAKIPE KRVSPSKPAS APAVKPGSKS
760 770 780 790 800
TQAVPKAPAT ATLASPGSTS RNLSTPLPKR PTAIKTEGKP AEIKKMATKS
810 820 830 840 850
APADLSRPKS TTTSSVKKST TVPGTAPPAG APSRARPTAT PPRPSGTPPV
860 870 880 890 900
DKKPTAAKPT SSAPRLGRVA ANASAPDLKN VRSKVGSTEN IKHQPGGGRA
910 920 930 940 950
KVEKKTEAAA PARKPEPNAV TKAAGPIGNA QKPPTGKVQI QNKKVDISKV
960 970 980 990 1000
SSKCGSKANI KHKPGGGDVK IESQKLNFKE KAQAKVGSLD NVGHLPAGGA
1010 1020 1030 1040 1050
VKTEGGGSEA PPCPGPPAGE ELAIPEAAPE AGAPASASGL SGHTTLAGGG
1060 1070
DQREAQTLDS QIQETSKWLG LA
Length:1,072
Mass (Da):111,915
Last modified:June 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE8C17A730989F0D2
GO
Isoform 2 (identifier: P36225-2) [UniParc]FASTAAdd to basket
Also known as: R3

The sequence of this isoform differs from the canonical sequence as follows:
     900-937: Missing.
     1067-1067: K → I
     1068-1072: Missing.

Show »
Length:1,029
Mass (Da):107,553
Checksum:iBF4CA1BC23FDD735
GO
Isoform 3 (identifier: P36225-3) [UniParc]FASTAAdd to basket
Also known as: R5

The sequence of this isoform differs from the canonical sequence as follows:
     937-937: K → KVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGN
     1067-1067: K → I
     1068-1072: Missing.

Show »
Length:1,098
Mass (Da):114,637
Checksum:i2A61408C03FC5B82
GO
Isoform 4 (identifier: P36225-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-720: Missing.
     937-937: K → KVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGN
     1067-1067: K → I
     1068-1072: Missing.

Show »
Length:1,026
Mass (Da):107,404
Checksum:i5BE42AB689488FF1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_032060649 – 720Missing in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_032061900 – 937Missing in isoform 2. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_032062937K → KVQIVSKKVSYSHIQSKCGS KDNIKHVPGGGN in isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_0320631067K → I in isoform 2, isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_0320641068 – 1072Missing in isoform 2, isoform 3 and isoform 4. 2 Publications5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D90149 mRNA Translation: BAA14179.1
AB079579 mRNA Translation: BAC07258.1
AB079580 mRNA Translation: BAC07259.1
AB354119 mRNA Translation: BAF75374.1
AB100953 mRNA Translation: BAC56093.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A37127

NCBI Reference Sequences

More...
RefSeqi
NP_776530.1, NM_174105.2 [P36225-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
281295

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
bta:281295

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D90149 mRNA Translation: BAA14179.1
AB079579 mRNA Translation: BAC07258.1
AB079580 mRNA Translation: BAC07259.1
AB354119 mRNA Translation: BAF75374.1
AB100953 mRNA Translation: BAC56093.1
PIRiA37127
RefSeqiNP_776530.1, NM_174105.2 [P36225-1]

3D structure databases

BMRBiP36225
SMRiP36225
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000021045

PTM databases

iPTMnetiP36225

Proteomic databases

PaxDbiP36225
PeptideAtlasiP36225
PRIDEiP36225

Genome annotation databases

GeneIDi281295
KEGGibta:281295

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4134

Phylogenomic databases

eggNOGiKOG2418, Eukaryota
InParanoidiP36225
OrthoDBi716848at2759

Family and domain databases

InterProiView protein in InterPro
IPR027323, MAP4
IPR001084, MAP_tubulin-bd_rpt
PANTHERiPTHR11501:SF16, PTHR11501:SF16, 1 hit
PfamiView protein in Pfam
PF00418, Tubulin-binding, 3 hits
PROSITEiView protein in PROSITE
PS00229, TAU_MAP_1, 3 hits
PS51491, TAU_MAP_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAP4_BOVIN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P36225
Secondary accession number(s): A7BKA6
, Q867A8, Q8MJX2, Q8MJX3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: February 10, 2021
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again