Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P35813 (PPM1A_HUMAN)

Protein

Protein phosphatase 1A

Gene

PPM1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. Dephosphorylates PRKAA1 and PRKAA2. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+, Mn2+Note: Binds 2 magnesium or manganese ions per subunit.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi60Manganese 11
Metal bindingi60Manganese 21
Metal bindingi61Manganese 1; via carbonyl oxygen1
Metal bindingi239Manganese 21
Metal bindingi282Manganese 21

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
LigandMagnesium, Manganese, Metal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.3.16 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2173795 Downregulation of SMAD2/3:SMAD4 transcriptional activity
R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P35813

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P35813

SIGNOR Signaling Network Open Resource

More...SIGNORi		P35813

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein phosphatase 1A (EC:3.1.3.16)
Alternative name(s):
Protein phosphatase 2C isoform alpha
Short name:
PP2C-alpha
Protein phosphatase IA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPM1A
Synonyms:PPPM1A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000100614.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:9275 PPM1A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		606108 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P35813

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi239D → N: No effect on binding SMAD2. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5494

Open Targets

More...OpenTargetsi		ENSG00000100614

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33603

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2437

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PPM1A

Domain mapping of disease mutations (DMDM)

More...DMDMi		548442

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000577412 – 382Protein phosphatase 1AAdd BLAST381

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine2 Publications1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei375PhosphoserineCombined sources1
Modified residuei377PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-myristoylation is essential for the recognition of its substrates for dephosphorylation.By similarity

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P35813

MaxQB - The MaxQuant DataBase

More...MaxQBi		P35813

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P35813

PeptideAtlas

More...PeptideAtlasi		P35813

PRoteomics IDEntifications database

More...PRIDEi		P35813

ProteomicsDB human proteome resource

More...ProteomicsDBi		55156
55157 [P35813-2]

PTM databases

DEPOD human dephosphorylation database

More...DEPODi		P35813

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P35813

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P35813

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000100614 Expressed in 239 organ(s), highest expression level in blood

CleanEx database of gene expression profiles

More...CleanExi		HS_PPM1A

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P35813 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P35813 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA029209

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Interacts with SMAD2; the interaction dephosphorylates SMAD2 in its C-terminal SXS motif resulting in disruption of the SMAD2/SMAD4 complex, SMAD2 nuclear export and termination of the TGF-beta-mediated signaling. Interacts with SMAD2; the interaction dephosphorylates SMAD2 in its C-terminal SXS motif resulting in disruption of the SMAD2/SMAD4 complex, SMAD2 nuclear export and termination of the TGF-beta-mediated signaling. Interacts with the phosphorylated form of IKBKB/IKKB.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111489, 95 interactors

Protein interaction database and analysis system

More...IntActi		P35813, 37 interactors

Molecular INTeraction database

More...MINTi		P35813

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000327255

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P35813

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1382
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P35813

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P35813

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P35813

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini23 – 291PPM-type phosphatasePROSITE-ProRule annotationAdd BLAST269

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PP2C family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0697 Eukaryota
COG0631 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154832

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000233895

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG053647

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P35813

KEGG Orthology (KO)

More...KOi		K04457

Identification of Orthologs from Complete Genome Data

More...OMAi		DWGYFAI

Database of Orthologous Groups

More...OrthoDBi		EOG091G0AJQ

Database for complete collections of gene phylogenies

More...PhylomeDBi		P35813

TreeFam database of animal gene trees

More...TreeFami		TF313590

Family and domain databases

Conserved Domains Database

More...CDDi		cd00143 PP2Cc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.10.430, 1 hit
3.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015655 PP2C
IPR000222 PP2C_BS
IPR012911 PP2C_C
IPR036580 PP2C_C_sf
IPR036457 PPM-type_dom_sf
IPR001932 PPM-type_phosphatase_dom

The PANTHER Classification System

More...PANTHERi		PTHR13832 PTHR13832, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00481 PP2C, 1 hit
PF07830 PP2C_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00332 PP2Cc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF81601 SSF81601, 1 hit
SSF81606 SSF81606, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01032 PPM_1, 1 hit
PS51746 PPM_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha-1 (identifier: P35813-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAFLDKPKM EKHNAQGQGN GLRYGLSSMQ GWRVEMEDAH TAVIGLPSGL 
        60         70         80         90        100
ESWSFFAVYD GHAGSQVAKY CCEHLLDHIT NNQDFKGSAG APSVENVKNG 
       110        120        130        140        150
IRTGFLEIDE HMRVMSEKKH GADRSGSTAV GVLISPQHTY FINCGDSRGL 
       160        170        180        190        200
LCRNRKVHFF TQDHKPSNPL EKERIQNAGG SVMIQRVNGS LAVSRALGDF 
       210        220        230        240        250
DYKCVHGKGP TEQLVSPEPE VHDIERSEED DQFIILACDG IWDVMGNEEL 
       260        270        280        290        300
CDFVRSRLEV TDDLEKVCNE VVDTCLYKGS RDNMSVILIC FPNAPKVSPE 
       310        320        330        340        350
AVKKEAELDK YLECRVEEII KKQGEGVPDL VHVMRTLASE NIPSLPPGGE 
       360        370        380 
LASKRNVIEA VYNRLNPYKN DDTDSTSTDD MW
Length:382
Mass (Da):42,448
Last modified:June 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD48EF508B4A76687
GO
Isoform Alpha-2 (identifier: P35813-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     318-324: EIIKKQG → GGSFNKK
     325-382: Missing.

Show »
Length:324
Mass (Da):35,958
Checksum:iED58E203BB26CE00
GO
Isoform 3 (identifier: P35813-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFCSGRKWVAEATICTKLMKREKRRMGKRRAKKAKREEKKKGGERRRNEKRGNQMKRMCERKKYETDLEDQDIM

Note: No experimental confirmation available.Curated
Show »
Length:455
Mass (Da):51,366
Checksum:iCBC6E3F350D6FDBD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PKB5E9PKB5_HUMAN
Protein phosphatase 1A
PPM1A
187Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJN3E9PJN3_HUMAN
Protein phosphatase 1A
PPM1A
148Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PL75E9PL75_HUMAN
Protein phosphatase 1A
PPM1A
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PP44E9PP44_HUMAN
Protein phosphatase 1A
PPM1A
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNE1E9PNE1_HUMAN
Protein phosphatase 1A
PPM1A
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti342I → T in AK097843 (PubMed:14702039).Curated1
Isoform 3 (identifier: P35813-3)
Sequence conflicti54Q → R in AK097843 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456871M → MFCSGRKWVAEATICTKLMK REKRRMGKRRAKKAKREEKK KGGERRRNEKRGNQMKRMCE RKKYETDLEDQDIM in isoform 3. 1 Publication1
Alternative sequenceiVSP_005085318 – 324EIIKKQG → GGSFNKK in isoform Alpha-2. 1 Publication7
Alternative sequenceiVSP_005086325 – 382Missing in isoform Alpha-2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
S87759 mRNA Translation: AAB21784.1
AF070670 mRNA Translation: AAC28354.1
AK097843 mRNA No translation available.
AB451247 mRNA Translation: BAG70061.1
AL132778 Genomic DNA No translation available.
AL157756 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80774.1
BC026691 mRNA Translation: AAH26691.1
BC063243 mRNA Translation: AAH63243.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS45120.1 [P35813-3]
CCDS9744.1 [P35813-1]
CCDS9745.1 [P35813-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S22423

NCBI Reference Sequences

More...RefSeqi		NP_066283.1, NM_021003.4 [P35813-1]
NP_808820.1, NM_177951.2 [P35813-2]
NP_808821.2, NM_177952.2 [P35813-3]
XP_005267836.1, XM_005267779.1 [P35813-1]
XP_005267838.1, XM_005267781.1 [P35813-1]
XP_011535180.1, XM_011536878.1 [P35813-1]
XP_011535181.1, XM_011536879.2 [P35813-1]
XP_011535182.1, XM_011536880.2 [P35813-1]
XP_011535183.1, XM_011536881.2 [P35813-1]
XP_011535184.1, XM_011536882.2 [P35813-1]
XP_011535185.1, XM_011536883.1 [P35813-1]
XP_011535186.1, XM_011536884.1
XP_016876873.1, XM_017021384.1 [P35813-1]
XP_016876874.1, XM_017021385.1 [P35813-1]
XP_016876875.1, XM_017021386.1 [P35813-1]
XP_016876876.1, XM_017021387.1 [P35813-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.130036

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000325642; ENSP00000327255; ENSG00000100614 [P35813-3]
ENST00000325658; ENSP00000314850; ENSG00000100614 [P35813-2]
ENST00000395076; ENSP00000378514; ENSG00000100614 [P35813-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5494

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5494

UCSC genome browser

More...UCSCi		uc001xew.5 human [P35813-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S87759 mRNA Translation: AAB21784.1
AF070670 mRNA Translation: AAC28354.1
AK097843 mRNA No translation available.
AB451247 mRNA Translation: BAG70061.1
AL132778 Genomic DNA No translation available.
AL157756 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80774.1
BC026691 mRNA Translation: AAH26691.1
BC063243 mRNA Translation: AAH63243.1
CCDSiCCDS45120.1 [P35813-3]
CCDS9744.1 [P35813-1]
CCDS9745.1 [P35813-2]
PIRiS22423
RefSeqiNP_066283.1, NM_021003.4 [P35813-1]
NP_808820.1, NM_177951.2 [P35813-2]
NP_808821.2, NM_177952.2 [P35813-3]
XP_005267836.1, XM_005267779.1 [P35813-1]
XP_005267838.1, XM_005267781.1 [P35813-1]
XP_011535180.1, XM_011536878.1 [P35813-1]
XP_011535181.1, XM_011536879.2 [P35813-1]
XP_011535182.1, XM_011536880.2 [P35813-1]
XP_011535183.1, XM_011536881.2 [P35813-1]
XP_011535184.1, XM_011536882.2 [P35813-1]
XP_011535185.1, XM_011536883.1 [P35813-1]
XP_011535186.1, XM_011536884.1
XP_016876873.1, XM_017021384.1 [P35813-1]
XP_016876874.1, XM_017021385.1 [P35813-1]
XP_016876875.1, XM_017021386.1 [P35813-1]
XP_016876876.1, XM_017021387.1 [P35813-1]
UniGeneiHs.130036

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1A6QX-ray2.00A1-382[»]
3FXJX-ray2.50A1-382[»]
3FXKX-ray2.10A1-382[»]
3FXLX-ray2.30A1-382[»]
3FXMX-ray2.50A1-382[»]
3FXOX-ray2.50A1-382[»]
4RA2X-ray1.94A2-368[»]
4RAFX-ray2.00A2-368[»]
4RAGX-ray1.85A2-368[»]
6B67X-ray2.20A/B/C2-297[»]
ProteinModelPortaliP35813
SMRiP35813
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111489, 95 interactors
IntActiP35813, 37 interactors
MINTiP35813
STRINGi9606.ENSP00000327255

Chemistry databases

BindingDBiP35813
ChEMBLiCHEMBL2437

PTM databases

DEPODiP35813
iPTMnetiP35813
PhosphoSitePlusiP35813

Polymorphism and mutation databases

BioMutaiPPM1A
DMDMi548442

Proteomic databases

EPDiP35813
MaxQBiP35813
PaxDbiP35813
PeptideAtlasiP35813
PRIDEiP35813
ProteomicsDBi55156
55157 [P35813-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		5494
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325642; ENSP00000327255; ENSG00000100614 [P35813-3]
ENST00000325658; ENSP00000314850; ENSG00000100614 [P35813-2]
ENST00000395076; ENSP00000378514; ENSG00000100614 [P35813-1]
GeneIDi5494
KEGGihsa:5494
UCSCiuc001xew.5 human [P35813-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5494
DisGeNETi5494
EuPathDBiHostDB:ENSG00000100614.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		PPM1A
HGNCiHGNC:9275 PPM1A
HPAiHPA029209
MIMi606108 gene
neXtProtiNX_P35813
OpenTargetsiENSG00000100614
PharmGKBiPA33603

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0697 Eukaryota
COG0631 LUCA
GeneTreeiENSGT00940000154832
HOGENOMiHOG000233895
HOVERGENiHBG053647
InParanoidiP35813
KOiK04457
OMAiDWGYFAI
OrthoDBiEOG091G0AJQ
PhylomeDBiP35813
TreeFamiTF313590

Enzyme and pathway databases

BRENDAi3.1.3.16 2681
ReactomeiR-HSA-2173795 Downregulation of SMAD2/3:SMAD4 transcriptional activity
R-HSA-380972 Energy dependent regulation of mTOR by LKB1-AMPK
SABIO-RKiP35813
SignaLinkiP35813
SIGNORiP35813

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PPM1A human
EvolutionaryTraceiP35813

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PPM1A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5494

Protein Ontology

More...PROi		PR:P35813

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000100614 Expressed in 239 organ(s), highest expression level in blood
CleanExiHS_PPM1A
ExpressionAtlasiP35813 baseline and differential
GenevisibleiP35813 HS

Family and domain databases

CDDicd00143 PP2Cc, 1 hit
Gene3Di1.10.10.430, 1 hit
3.60.40.10, 1 hit
InterProiView protein in InterPro
IPR015655 PP2C
IPR000222 PP2C_BS
IPR012911 PP2C_C
IPR036580 PP2C_C_sf
IPR036457 PPM-type_dom_sf
IPR001932 PPM-type_phosphatase_dom
PANTHERiPTHR13832 PTHR13832, 1 hit
PfamiView protein in Pfam
PF00481 PP2C, 1 hit
PF07830 PP2C_C, 1 hit
SMARTiView protein in SMART
SM00332 PP2Cc, 1 hit
SUPFAMiSSF81601 SSF81601, 1 hit
SSF81606 SSF81606, 1 hit
PROSITEiView protein in PROSITE
PS01032 PPM_1, 1 hit
PS51746 PPM_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPPM1A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35813
Secondary accession number(s): B5BU11, J3KNM0, O75551
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: December 5, 2018
This is version 192 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again