Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-adducin

Gene

ADD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.

GO - Molecular functioni

  • actin binding Source: ProtInc
  • actin filament binding Source: BHF-UCL
  • cadherin binding Source: BHF-UCL
  • calmodulin binding Source: UniProtKB-KW
  • protein heterodimerization activity Source: BHF-UCL
  • protein homodimerization activity Source: BHF-UCL
  • RNA binding Source: UniProtKB
  • spectrin binding Source: BHF-UCL
  • structural molecule activity Source: GO_Central
  • transcription factor binding Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionActin-binding, Calmodulin-binding

Enzyme and pathway databases

ReactomeiR-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-5223345 Miscellaneous transport and binding events
SIGNORiP35611

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-adducin
Alternative name(s):
Erythrocyte adducin subunit alpha
Gene namesi
Name:ADD1
Synonyms:ADDA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000087274.16
HGNCiHGNC:243 ADD1
MIMi102680 gene
neXtProtiNX_P35611

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi445T → D: Abolishes phosphorylation by ROCK2; when associated with D-480. 1 Publication1
Mutagenesisi480T → D: Abolishes phosphorylation by ROCK2; when associated with D-445. 1 Publication1

Organism-specific databases

DisGeNETi118
MalaCardsiADD1
OpenTargetsiENSG00000087274
PharmGKBiPA31

Polymorphism and mutation databases

BioMutaiADD1
DMDMi12644231

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002185301 – 737Alpha-adducinAdd BLAST737

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei59Phosphoserine; by PKACombined sources1 Publication1
Modified residuei64PhosphoserineCombined sources1
Modified residuei331PhosphothreonineCombined sources1
Modified residuei334PhosphoserineCombined sources1
Modified residuei353PhosphoserineCombined sources1
Modified residuei355PhosphoserineCombined sources1
Modified residuei358PhosphoserineCombined sources1
Modified residuei366PhosphoserineCombined sources1
Modified residuei408Phosphoserine; by PKA1 Publication1
Modified residuei427PhosphoserineBy similarity1
Modified residuei429PhosphothreonineBy similarity1
Modified residuei431PhosphoserineCombined sources1
Modified residuei436Phosphoserine; by PKACombined sources1 Publication1
Modified residuei445Phosphothreonine; by ROCK21 Publication1
Modified residuei464PhosphoserineBy similarity1
Modified residuei465PhosphoserineCombined sources1
Modified residuei480Phosphothreonine; by ROCK21 Publication1
Modified residuei481Phosphoserine; by PKA1 Publication1
Modified residuei586PhosphoserineBy similarity1
Modified residuei600PhosphoserineBy similarity1
Modified residuei613PhosphoserineBy similarity1
Modified residuei614PhosphothreonineBy similarity1
Modified residuei678PhosphoserineCombined sources1
Modified residuei707PhosphoserineCombined sources1
Modified residuei710PhosphoserineCombined sources1
Modified residuei714PhosphoserineCombined sources1
Modified residuei716Phosphoserine; by PKCCombined sources1 Publication1
Modified residuei726Phosphoserine; by PKA and PKC1 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP35611
MaxQBiP35611
PaxDbiP35611
PeptideAtlasiP35611
PRIDEiP35611
ProteomicsDBi55102
55103 [P35611-2]
55104 [P35611-3]

PTM databases

iPTMnetiP35611
PhosphoSitePlusiP35611

Miscellaneous databases

PMAP-CutDBiP35611

Expressioni

Tissue specificityi

Expressed in all tissues. Found in much higher levels in reticulocytes than the beta subunit.

Gene expression databases

BgeeiENSG00000087274 Expressed in 239 organ(s), highest expression level in fundus of stomach
CleanExiHS_ADD1
ExpressionAtlasiP35611 baseline and differential
GenevisibleiP35611 HS

Organism-specific databases

HPAiCAB009794
HPA035873
HPA035874

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit or an alpha and a gamma subunit.

Binary interactionsi

WithEntry#Exp.IntActNotes
HMG20AQ9NP663EBI-10206868,EBI-740641

GO - Molecular functioni

Protein-protein interaction databases

BioGridi106631, 61 interactors
IntActiP35611, 46 interactors
MINTiP35611
STRINGi9606.ENSP00000264758

Structurei

3D structure databases

DisProtiDP00240
ProteinModelPortaliP35611
SMRiP35611
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni717 – 734Interaction with calmodulinSequence analysisAdd BLAST18

Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3699 Eukaryota
COG0235 LUCA
GeneTreeiENSGT00390000016462
HOGENOMiHOG000116349
HOVERGENiHBG004180
InParanoidiP35611
KOiK18622
OMAiQKGPEEN
OrthoDBiEOG091G0324
PhylomeDBiP35611
TreeFamiTF313003

Family and domain databases

Gene3Di3.40.225.10, 1 hit
InterProiView protein in InterPro
IPR027766 ADD1
IPR001303 Aldolase_II/adducin_N
IPR036409 Aldolase_II/adducin_N_sf
PANTHERiPTHR10672:SF4 PTHR10672:SF4, 1 hit
PfamiView protein in Pfam
PF00596 Aldolase_II, 1 hit
SMARTiView protein in SMART
SM01007 Aldolase_II, 1 hit
SUPFAMiSSF53639 SSF53639, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P35611-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGDSRAAVV TSPPPTTAPH KERYFDRVDE NNPEYLRERN MAPDLRQDFN
60 70 80 90 100
MMEQKKRVSM ILQSPAFCEE LESMIQEQFK KGKNPTGLLA LQQIADFMTT
110 120 130 140 150
NVPNVYPAAP QGGMAALNMS LGMVTPVNDL RGSDSIAYDK GEKLLRCKLA
160 170 180 190 200
AFYRLADLFG WSQLIYNHIT TRVNSEQEHF LIVPFGLLYS EVTASSLVKI
210 220 230 240 250
NLQGDIVDRG STNLGVNQAG FTLHSAIYAA RPDVKCVVHI HTPAGAAVSA
260 270 280 290 300
MKCGLLPISP EALSLGEVAY HDYHGILVDE EEKVLIQKNL GPKSKVLILR
310 320 330 340 350
NHGLVSVGES VEEAFYYIHN LVVACEIQVR TLASAGGPDN LVLLNPEKYK
360 370 380 390 400
AKSRSPGSPV GEGTGSPPKW QIGEQEFEAL MRMLDNLGYR TGYPYRYPAL
410 420 430 440 450
REKSKKYSDV EVPASVTGYS FASDGDSGTC SPLRHSFQKQ QREKTRWLNS
460 470 480 490 500
GRGDEASEEG QNGSSPKSKT KWTKEDGHRT STSAVPNLFV PLNTNPKEVQ
510 520 530 540 550
EMRNKIREQN LQDIKTAGPQ SQVLCGVVMD RSLVQGELVT ASKAIIEKEY
560 570 580 590 600
QPHVIVSTTG PNPFTTLTDR ELEEYRREVE RKQKGSEENL DEAREQKEKS
610 620 630 640 650
PPDQPAVPHP PPSTPIKLEE DLVPEPTTGD DSDAATFKPT LPDLSPDEPS
660 670 680 690 700
EALGFPMLEK EEEAHRPPSP TEAPTEASPE PAPDPAPVAE EAAPSAVEEG
710 720 730
AAADPGSDGS PGKSPSKKKK KFRTPSFLKK SKKKSDS
Length:737
Mass (Da):80,955
Last modified:December 1, 2000 - v2
Checksum:iDF13AB30B12F20B6
GO
Isoform 2 (identifier: P35611-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Show »
Length:631
Mass (Da):69,985
Checksum:i350DDCF58AB61357
GO
Isoform 3 (identifier: P35611-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL

Show »
Length:768
Mass (Da):84,303
Checksum:iD97BFFA790F661CA
GO
Isoform 4 (identifier: P35611-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: Q → QDAPLSDCTETIEGLELTEQTFSPAKSLSFRK
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Note: No experimental confirmation available.
Show »
Length:662
Mass (Da):73,382
Checksum:i28B30DE00E7C3624
GO
Isoform 5 (identifier: P35611-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     472-511: WTKEDGHRTS...MRNKIREQNL → VWTNITHDHV...LVCAYLTVHS
     512-737: Missing.

Note: No experimental confirmation available.
Show »
Length:511
Mass (Da):56,286
Checksum:i4CD8F88129465C07
GO
Isoform 6 (identifier: P35611-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Show »
Length:662
Mass (Da):73,333
Checksum:i2F406B91F481F774
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y9H2H0Y9H2_HUMAN
Alpha-adducin
ADD1
444Annotation score:
E7EV99E7EV99_HUMAN
Alpha-adducin
ADD1
632Annotation score:
E7ENY0E7ENY0_HUMAN
Alpha-adducin
ADD1
663Annotation score:
H0YG19H0YG19_HUMAN
Alpha-adducin
ADD1
114Annotation score:
A0A0A0MSR2A0A0A0MSR2_HUMAN
Alpha-adducin
ADD1
400Annotation score:
D6RF25D6RF25_HUMAN
Alpha-adducin
ADD1
142Annotation score:
D6RJE2D6RJE2_HUMAN
Alpha-adducin
ADD1
69Annotation score:
H0YFD8H0YFD8_HUMAN
Alpha-adducin
ADD1
105Annotation score:
D6RAH3D6RAH3_HUMAN
Alpha-adducin
ADD1
137Annotation score:

Sequence cautioni

The sequence CAA98970 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti606A → E in AAB05645 (PubMed:7774961).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0221086R → C. Corresponds to variant dbSNP:rs2295497Ensembl.1
Natural variantiVAR_014863270Y → N. Corresponds to variant dbSNP:rs4971Ensembl.1
Natural variantiVAR_014864376E → D. Corresponds to variant dbSNP:rs4972Ensembl.1
Natural variantiVAR_014184460G → W2 PublicationsCorresponds to variant dbSNP:rs4961EnsemblClinVar.1
Natural variantiVAR_014865510N → I. Corresponds to variant dbSNP:rs4962Ensembl.1
Natural variantiVAR_014185586S → C2 PublicationsCorresponds to variant dbSNP:rs4963Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000174471K → KVWTNITHDHVKPLLQSLSS GVCVPSCITNCL in isoform 3 and isoform 6. 1 Publication1
Alternative sequenceiVSP_055402472 – 511WTKED…REQNL → VWTNITHDHVKPLLQSLSSG VCVPSCITNCLVCAYLTVHS in isoform 5. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_055403512 – 737Missing in isoform 5. 1 PublicationAdd BLAST226
Alternative sequenceiVSP_054420535Q → QDAPLSDCTETIEGLELTEQ TFSPAKSLSFRK in isoform 4. 1 Publication1
Alternative sequenceiVSP_000175621 – 631DLVPEPTTGDD → GDGCAREYLLP in isoform 2, isoform 4 and isoform 6. 2 PublicationsAdd BLAST11
Alternative sequenceiVSP_000176632 – 737Missing in isoform 2, isoform 4 and isoform 6. 2 PublicationsAdd BLAST106

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X58141 mRNA Translation: CAA41149.1
L07261 mRNA No translation available.
L29296
, L29286, L29287, L29289, L29290, L29291, L29292, L29293, L29294, L29295, L29297, L29298 Genomic DNA Translation: AAB05645.1
AK295457 mRNA Translation: BAG58391.1
Z74617 Genomic DNA Translation: CAA98970.1 Sequence problems.
Z68280 Genomic DNA No translation available.
AL390065, AL121750, BX465861 Genomic DNA Translation: CAM21299.1
BX465861, AL121750, AL390065 Genomic DNA Translation: CAM25274.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28230.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28231.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28232.1
CH471131 Genomic DNA Translation: EAW82498.1
CH471131 Genomic DNA Translation: EAW82499.1
CH471131 Genomic DNA Translation: EAW82501.1
CH471131 Genomic DNA Translation: EAW82502.1
CH471131 Genomic DNA Translation: EAW82503.1
CH471131 Genomic DNA Translation: EAW82504.1
CH471131 Genomic DNA Translation: EAW82505.1
BC042998 mRNA Translation: AAH42998.1
AH004561 mRNA Translation: AAB30914.2
CCDSiCCDS3363.1 [P35611-3]
CCDS3364.1 [P35611-6]
CCDS43205.1 [P35611-1]
CCDS75094.1 [P35611-4]
PIRiS18207
RefSeqiNP_001110.2, NM_001119.4 [P35611-1]
NP_001273574.1, NM_001286645.1 [P35611-4]
NP_054908.2, NM_014189.3 [P35611-3]
NP_054909.2, NM_014190.3 [P35611-2]
NP_789771.1, NM_176801.2 [P35611-6]
XP_005247994.1, XM_005247937.2
XP_016863193.1, XM_017007704.1 [P35611-3]
XP_016863195.1, XM_017007706.1 [P35611-1]
XP_016863196.1, XM_017007707.1
XP_016863197.1, XM_017007708.1
XP_016863198.1, XM_017007709.1 [P35611-2]
XP_016863199.1, XM_017007710.1
UniGeneiHs.183706

Genome annotation databases

EnsembliENST00000264758; ENSP00000264758; ENSG00000087274 [P35611-3]
ENST00000355842; ENSP00000348100; ENSG00000087274 [P35611-4]
ENST00000398123; ENSP00000381191; ENSG00000087274 [P35611-6]
ENST00000398125; ENSP00000381193; ENSG00000087274 [P35611-6]
ENST00000398129; ENSP00000381197; ENSG00000087274 [P35611-1]
GeneIDi118
KEGGihsa:118
UCSCiuc003gfo.4 human [P35611-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X58141 mRNA Translation: CAA41149.1
L07261 mRNA No translation available.
L29296
, L29286, L29287, L29289, L29290, L29291, L29292, L29293, L29294, L29295, L29297, L29298 Genomic DNA Translation: AAB05645.1
AK295457 mRNA Translation: BAG58391.1
Z74617 Genomic DNA Translation: CAA98970.1 Sequence problems.
Z68280 Genomic DNA No translation available.
AL390065, AL121750, BX465861 Genomic DNA Translation: CAM21299.1
BX465861, AL121750, AL390065 Genomic DNA Translation: CAM25274.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28230.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28231.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28232.1
CH471131 Genomic DNA Translation: EAW82498.1
CH471131 Genomic DNA Translation: EAW82499.1
CH471131 Genomic DNA Translation: EAW82501.1
CH471131 Genomic DNA Translation: EAW82502.1
CH471131 Genomic DNA Translation: EAW82503.1
CH471131 Genomic DNA Translation: EAW82504.1
CH471131 Genomic DNA Translation: EAW82505.1
BC042998 mRNA Translation: AAH42998.1
AH004561 mRNA Translation: AAB30914.2
CCDSiCCDS3363.1 [P35611-3]
CCDS3364.1 [P35611-6]
CCDS43205.1 [P35611-1]
CCDS75094.1 [P35611-4]
PIRiS18207
RefSeqiNP_001110.2, NM_001119.4 [P35611-1]
NP_001273574.1, NM_001286645.1 [P35611-4]
NP_054908.2, NM_014189.3 [P35611-3]
NP_054909.2, NM_014190.3 [P35611-2]
NP_789771.1, NM_176801.2 [P35611-6]
XP_005247994.1, XM_005247937.2
XP_016863193.1, XM_017007704.1 [P35611-3]
XP_016863195.1, XM_017007706.1 [P35611-1]
XP_016863196.1, XM_017007707.1
XP_016863197.1, XM_017007708.1
XP_016863198.1, XM_017007709.1 [P35611-2]
XP_016863199.1, XM_017007710.1
UniGeneiHs.183706

3D structure databases

DisProtiDP00240
ProteinModelPortaliP35611
SMRiP35611
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106631, 61 interactors
IntActiP35611, 46 interactors
MINTiP35611
STRINGi9606.ENSP00000264758

PTM databases

iPTMnetiP35611
PhosphoSitePlusiP35611

Polymorphism and mutation databases

BioMutaiADD1
DMDMi12644231

Proteomic databases

EPDiP35611
MaxQBiP35611
PaxDbiP35611
PeptideAtlasiP35611
PRIDEiP35611
ProteomicsDBi55102
55103 [P35611-2]
55104 [P35611-3]

Protocols and materials databases

DNASUi118
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264758; ENSP00000264758; ENSG00000087274 [P35611-3]
ENST00000355842; ENSP00000348100; ENSG00000087274 [P35611-4]
ENST00000398123; ENSP00000381191; ENSG00000087274 [P35611-6]
ENST00000398125; ENSP00000381193; ENSG00000087274 [P35611-6]
ENST00000398129; ENSP00000381197; ENSG00000087274 [P35611-1]
GeneIDi118
KEGGihsa:118
UCSCiuc003gfo.4 human [P35611-1]

Organism-specific databases

CTDi118
DisGeNETi118
EuPathDBiHostDB:ENSG00000087274.16
GeneCardsiADD1
HGNCiHGNC:243 ADD1
HPAiCAB009794
HPA035873
HPA035874
MalaCardsiADD1
MIMi102680 gene
neXtProtiNX_P35611
OpenTargetsiENSG00000087274
PharmGKBiPA31
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3699 Eukaryota
COG0235 LUCA
GeneTreeiENSGT00390000016462
HOGENOMiHOG000116349
HOVERGENiHBG004180
InParanoidiP35611
KOiK18622
OMAiQKGPEEN
OrthoDBiEOG091G0324
PhylomeDBiP35611
TreeFamiTF313003

Enzyme and pathway databases

ReactomeiR-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-5223345 Miscellaneous transport and binding events
SIGNORiP35611

Miscellaneous databases

ChiTaRSiADD1 human
GeneWikiiADD1
GenomeRNAii118
PMAP-CutDBiP35611
PROiPR:P35611
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000087274 Expressed in 239 organ(s), highest expression level in fundus of stomach
CleanExiHS_ADD1
ExpressionAtlasiP35611 baseline and differential
GenevisibleiP35611 HS

Family and domain databases

Gene3Di3.40.225.10, 1 hit
InterProiView protein in InterPro
IPR027766 ADD1
IPR001303 Aldolase_II/adducin_N
IPR036409 Aldolase_II/adducin_N_sf
PANTHERiPTHR10672:SF4 PTHR10672:SF4, 1 hit
PfamiView protein in Pfam
PF00596 Aldolase_II, 1 hit
SMARTiView protein in SMART
SM01007 Aldolase_II, 1 hit
SUPFAMiSSF53639 SSF53639, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiADDA_HUMAN
AccessioniPrimary (citable) accession number: P35611
Secondary accession number(s): A2A3N8
, A2A3P0, B4DI79, D3DVR3, D3DVR4, D3DVR5, Q13734, Q14729, Q16156, Q86XM2, Q9UJB6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: December 1, 2000
Last modified: November 7, 2018
This is version 186 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again