Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P35611 (ADDA_HUMAN)

Entry version 199 (22 Apr 2020)
Sequence version 2 (01 Dec 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Alpha-adducin

Gene

ADD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Calmodulin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-5223345 Miscellaneous transport and binding events

SIGNOR Signaling Network Open Resource

More...SIGNORi		P35611

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-adducin
Alternative name(s):
Erythrocyte adducin subunit alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADD1
Synonyms:ADDA
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:243 ADD1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		102680 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P35611

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi445T → D: Abolishes phosphorylation by ROCK2; when associated with D-480. 1 Publication1
Mutagenesisi480T → D: Abolishes phosphorylation by ROCK2; when associated with D-445. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		118

MalaCards human disease database

More...MalaCardsi		ADD1

Open Targets

More...OpenTargetsi		ENSG00000087274

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P35611 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADD1

Domain mapping of disease mutations (DMDM)

More...DMDMi		12644231

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002185301 – 737Alpha-adducinAdd BLAST737

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei59Phosphoserine; by PKACombined sources1 Publication1
Modified residuei64PhosphoserineCombined sources1
Modified residuei331PhosphothreonineCombined sources1
Modified residuei334PhosphoserineCombined sources1
Modified residuei353PhosphoserineCombined sources1
Modified residuei355PhosphoserineCombined sources1
Modified residuei358PhosphoserineCombined sources1
Modified residuei366PhosphoserineCombined sources1
Modified residuei408Phosphoserine; by PKA1 Publication1
Modified residuei427PhosphoserineBy similarity1
Modified residuei429PhosphothreonineBy similarity1
Modified residuei431PhosphoserineCombined sources1
Modified residuei436Phosphoserine; by PKACombined sources1 Publication1
Modified residuei445Phosphothreonine; by ROCK21 Publication1
Modified residuei464PhosphoserineBy similarity1
Modified residuei465PhosphoserineCombined sources1
Modified residuei480Phosphothreonine; by ROCK21 Publication1
Modified residuei481Phosphoserine; by PKA1 Publication1
Modified residuei586PhosphoserineBy similarity1
Modified residuei600PhosphoserineBy similarity1
Modified residuei613PhosphoserineBy similarity1
Modified residuei614PhosphothreonineBy similarity1
Modified residuei678PhosphoserineCombined sources1
Modified residuei707PhosphoserineCombined sources1
Modified residuei710PhosphoserineCombined sources1
Modified residuei714PhosphoserineCombined sources1
Modified residuei716Phosphoserine; by PKCCombined sources1 Publication1
Modified residuei726Phosphoserine; by PKA and PKC1 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P35611

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P35611

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P35611

MaxQB - The MaxQuant DataBase

More...MaxQBi		P35611

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P35611

PeptideAtlas

More...PeptideAtlasi		P35611

PRoteomics IDEntifications database

More...PRIDEi		P35611

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		289
55102 [P35611-1]
55103 [P35611-2]
55104 [P35611-3]
70300

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P35611

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P35611

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P35611

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P35611

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all tissues. Found in much higher levels in reticulocytes than the beta subunit.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000087274 Expressed in fundus of stomach and 238 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P35611 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P35611 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000087274 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta subunit or an alpha and a gamma subunit.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		106631, 72 interactors

Protein interaction database and analysis system

More...IntActi		P35611, 50 interactors

Molecular INTeraction database

More...MINTi		P35611

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000264758

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P35611 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P35611

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni717 – 734Interaction with calmodulinSequence analysisAdd BLAST18

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the aldolase class II family. Adducin subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3699 Eukaryota
COG0235 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158581

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P35611

KEGG Orthology (KO)

More...KOi		K18622

Identification of Orthologs from Complete Genome Data

More...OMAi		FMLHSAI

Database of Orthologous Groups

More...OrthoDBi		400524at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P35611

TreeFam database of animal gene trees

More...TreeFami		TF313003

Family and domain databases

Database of protein disorder

More...DisProti		DP00240

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.225.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR027766 ADD1
IPR001303 Aldolase_II/adducin_N
IPR036409 Aldolase_II/adducin_N_sf

The PANTHER Classification System

More...PANTHERi		PTHR10672:SF4 PTHR10672:SF4, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00596 Aldolase_II, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01007 Aldolase_II, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53639 SSF53639, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P35611-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGDSRAAVV TSPPPTTAPH KERYFDRVDE NNPEYLRERN MAPDLRQDFN 
        60         70         80         90        100
MMEQKKRVSM ILQSPAFCEE LESMIQEQFK KGKNPTGLLA LQQIADFMTT 
       110        120        130        140        150
NVPNVYPAAP QGGMAALNMS LGMVTPVNDL RGSDSIAYDK GEKLLRCKLA 
       160        170        180        190        200
AFYRLADLFG WSQLIYNHIT TRVNSEQEHF LIVPFGLLYS EVTASSLVKI 
       210        220        230        240        250
NLQGDIVDRG STNLGVNQAG FTLHSAIYAA RPDVKCVVHI HTPAGAAVSA 
       260        270        280        290        300
MKCGLLPISP EALSLGEVAY HDYHGILVDE EEKVLIQKNL GPKSKVLILR 
       310        320        330        340        350
NHGLVSVGES VEEAFYYIHN LVVACEIQVR TLASAGGPDN LVLLNPEKYK 
       360        370        380        390        400
AKSRSPGSPV GEGTGSPPKW QIGEQEFEAL MRMLDNLGYR TGYPYRYPAL 
       410        420        430        440        450
REKSKKYSDV EVPASVTGYS FASDGDSGTC SPLRHSFQKQ QREKTRWLNS 
       460        470        480        490        500
GRGDEASEEG QNGSSPKSKT KWTKEDGHRT STSAVPNLFV PLNTNPKEVQ 
       510        520        530        540        550
EMRNKIREQN LQDIKTAGPQ SQVLCGVVMD RSLVQGELVT ASKAIIEKEY 
       560        570        580        590        600
QPHVIVSTTG PNPFTTLTDR ELEEYRREVE RKQKGSEENL DEAREQKEKS 
       610        620        630        640        650
PPDQPAVPHP PPSTPIKLEE DLVPEPTTGD DSDAATFKPT LPDLSPDEPS 
       660        670        680        690        700
EALGFPMLEK EEEAHRPPSP TEAPTEASPE PAPDPAPVAE EAAPSAVEEG 
       710        720        730 
AAADPGSDGS PGKSPSKKKK KFRTPSFLKK SKKKSDS
Length:737
Mass (Da):80,955
Last modified:December 1, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDF13AB30B12F20B6
GO
Isoform 2 (identifier: P35611-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Show »
Length:631
Mass (Da):69,985
Checksum:i350DDCF58AB61357
GO
Isoform 3 (identifier: P35611-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL

Show »
Length:768
Mass (Da):84,303
Checksum:iD97BFFA790F661CA
GO
Isoform 4 (identifier: P35611-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     535-535: Q → QDAPLSDCTETIEGLELTEQTFSPAKSLSFRK
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Show »
Length:662
Mass (Da):73,382
Checksum:i28B30DE00E7C3624
GO
Isoform 5 (identifier: P35611-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     472-511: WTKEDGHRTS...MRNKIREQNL → VWTNITHDHV...LVCAYLTVHS
     512-737: Missing.

Show »
Length:511
Mass (Da):56,286
Checksum:i4CD8F88129465C07
GO
Isoform 6 (identifier: P35611-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     471-471: K → KVWTNITHDHVKPLLQSLSSGVCVPSCITNCL
     621-631: DLVPEPTTGDD → GDGCAREYLLP
     632-737: Missing.

Show »
Length:662
Mass (Da):73,333
Checksum:i2F406B91F481F774
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y9H2H0Y9H2_HUMAN
Alpha-adducin
ADD1
444Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ENY0E7ENY0_HUMAN
Alpha-adducin
ADD1
663Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EV99E7EV99_HUMAN
Alpha-adducin
ADD1
632Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG19H0YG19_HUMAN
Alpha-adducin
ADD1
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSR2A0A0A0MSR2_HUMAN
Alpha-adducin
ADD1
400Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RF25D6RF25_HUMAN
Alpha-adducin
ADD1
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAH3D6RAH3_HUMAN
Alpha-adducin
ADD1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RJE2D6RJE2_HUMAN
Alpha-adducin
ADD1
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFD8H0YFD8_HUMAN
Alpha-adducin
ADD1
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA98970 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti606A → E in AAB05645 (PubMed:7774961).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0221086R → C. Corresponds to variant dbSNP:rs2295497Ensembl.1
Natural variantiVAR_014863270Y → N. Corresponds to variant dbSNP:rs4971Ensembl.1
Natural variantiVAR_014864376E → D. Corresponds to variant dbSNP:rs4972Ensembl.1
Natural variantiVAR_014184460G → W2 PublicationsCorresponds to variant dbSNP:rs4961EnsemblClinVar.1
Natural variantiVAR_014865510N → I. Corresponds to variant dbSNP:rs4962Ensembl.1
Natural variantiVAR_014185586S → C2 PublicationsCorresponds to variant dbSNP:rs4963Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000174471K → KVWTNITHDHVKPLLQSLSS GVCVPSCITNCL in isoform 3 and isoform 6. 1 Publication1
Alternative sequenceiVSP_055402472 – 511WTKED…REQNL → VWTNITHDHVKPLLQSLSSG VCVPSCITNCLVCAYLTVHS in isoform 5. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_055403512 – 737Missing in isoform 5. 1 PublicationAdd BLAST226
Alternative sequenceiVSP_054420535Q → QDAPLSDCTETIEGLELTEQ TFSPAKSLSFRK in isoform 4. 1 Publication1
Alternative sequenceiVSP_000175621 – 631DLVPEPTTGDD → GDGCAREYLLP in isoform 2, isoform 4 and isoform 6. 2 PublicationsAdd BLAST11
Alternative sequenceiVSP_000176632 – 737Missing in isoform 2, isoform 4 and isoform 6. 2 PublicationsAdd BLAST106

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X58141 mRNA Translation: CAA41149.1
L07261 mRNA No translation available.
L29296 L29298 Genomic DNA Translation: AAB05645.1
AK295457 mRNA Translation: BAG58391.1
Z74617 Genomic DNA Translation: CAA98970.1 Sequence problems.
Z68280 Genomic DNA No translation available.
AL390065, AL121750, BX465861 Genomic DNA Translation: CAM21299.1
BX465861, AL121750, AL390065 Genomic DNA Translation: CAM25274.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28230.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28231.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28232.1
CH471131 Genomic DNA Translation: EAW82498.1
CH471131 Genomic DNA Translation: EAW82499.1
CH471131 Genomic DNA Translation: EAW82501.1
CH471131 Genomic DNA Translation: EAW82502.1
CH471131 Genomic DNA Translation: EAW82503.1
CH471131 Genomic DNA Translation: EAW82504.1
CH471131 Genomic DNA Translation: EAW82505.1
BC042998 mRNA Translation: AAH42998.1
AH004561 mRNA Translation: AAB30914.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3363.1 [P35611-3]
CCDS3364.1 [P35611-6]
CCDS43205.1 [P35611-1]
CCDS75094.1 [P35611-4]

Protein sequence database of the Protein Information Resource

More...PIRi		S18207

NCBI Reference Sequences

More...RefSeqi		NP_001110.2, NM_001119.4 [P35611-1]
NP_001273574.1, NM_001286645.1 [P35611-4]
NP_054908.2, NM_014189.3 [P35611-3]
NP_054909.2, NM_014190.3 [P35611-2]
NP_789771.1, NM_176801.2 [P35611-6]
XP_005247994.1, XM_005247937.2
XP_016863193.1, XM_017007704.1 [P35611-3]
XP_016863195.1, XM_017007706.1 [P35611-1]
XP_016863196.1, XM_017007707.1
XP_016863197.1, XM_017007708.1
XP_016863198.1, XM_017007709.1 [P35611-2]
XP_016863199.1, XM_017007710.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000264758; ENSP00000264758; ENSG00000087274 [P35611-3]
ENST00000355842; ENSP00000348100; ENSG00000087274 [P35611-4]
ENST00000398123; ENSP00000381191; ENSG00000087274 [P35611-6]
ENST00000398125; ENSP00000381193; ENSG00000087274 [P35611-6]
ENST00000398129; ENSP00000381197; ENSG00000087274 [P35611-1]
ENST00000651918; ENSP00000498269; ENSG00000087274 [P35611-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		118

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:118

UCSC genome browser

More...UCSCi		uc003gfo.4 human [P35611-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X58141 mRNA Translation: CAA41149.1
L07261 mRNA No translation available.
L29296 L29298 Genomic DNA Translation: AAB05645.1
AK295457 mRNA Translation: BAG58391.1
Z74617 Genomic DNA Translation: CAA98970.1 Sequence problems.
Z68280 Genomic DNA No translation available.
AL390065, AL121750, BX465861 Genomic DNA Translation: CAM21299.1
BX465861, AL121750, AL390065 Genomic DNA Translation: CAM25274.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28230.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28231.1
AL121750, AL390065, BX465861 Genomic DNA Translation: CAM28232.1
CH471131 Genomic DNA Translation: EAW82498.1
CH471131 Genomic DNA Translation: EAW82499.1
CH471131 Genomic DNA Translation: EAW82501.1
CH471131 Genomic DNA Translation: EAW82502.1
CH471131 Genomic DNA Translation: EAW82503.1
CH471131 Genomic DNA Translation: EAW82504.1
CH471131 Genomic DNA Translation: EAW82505.1
BC042998 mRNA Translation: AAH42998.1
AH004561 mRNA Translation: AAB30914.2
CCDSiCCDS3363.1 [P35611-3]
CCDS3364.1 [P35611-6]
CCDS43205.1 [P35611-1]
CCDS75094.1 [P35611-4]
PIRiS18207
RefSeqiNP_001110.2, NM_001119.4 [P35611-1]
NP_001273574.1, NM_001286645.1 [P35611-4]
NP_054908.2, NM_014189.3 [P35611-3]
NP_054909.2, NM_014190.3 [P35611-2]
NP_789771.1, NM_176801.2 [P35611-6]
XP_005247994.1, XM_005247937.2
XP_016863193.1, XM_017007704.1 [P35611-3]
XP_016863195.1, XM_017007706.1 [P35611-1]
XP_016863196.1, XM_017007707.1
XP_016863197.1, XM_017007708.1
XP_016863198.1, XM_017007709.1 [P35611-2]
XP_016863199.1, XM_017007710.1

3D structure databases

SMRiP35611
ModBaseiSearch...

Protein-protein interaction databases

BioGridi106631, 72 interactors
IntActiP35611, 50 interactors
MINTiP35611
STRINGi9606.ENSP00000264758

PTM databases

iPTMnetiP35611
MetOSiteiP35611
PhosphoSitePlusiP35611
SwissPalmiP35611

Polymorphism and mutation databases

BioMutaiADD1
DMDMi12644231

Proteomic databases

EPDiP35611
jPOSTiP35611
MassIVEiP35611
MaxQBiP35611
PaxDbiP35611
PeptideAtlasiP35611
PRIDEiP35611
ProteomicsDBi289
55102 [P35611-1]
55103 [P35611-2]
55104 [P35611-3]
70300

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4065 723 antibodies

The DNASU plasmid repository

More...DNASUi		118

Genome annotation databases

EnsembliENST00000264758; ENSP00000264758; ENSG00000087274 [P35611-3]
ENST00000355842; ENSP00000348100; ENSG00000087274 [P35611-4]
ENST00000398123; ENSP00000381191; ENSG00000087274 [P35611-6]
ENST00000398125; ENSP00000381193; ENSG00000087274 [P35611-6]
ENST00000398129; ENSP00000381197; ENSG00000087274 [P35611-1]
ENST00000651918; ENSP00000498269; ENSG00000087274 [P35611-2]
GeneIDi118
KEGGihsa:118
UCSCiuc003gfo.4 human [P35611-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		118
DisGeNETi118

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADD1
HGNCiHGNC:243 ADD1
HPAiENSG00000087274 Low tissue specificity
MalaCardsiADD1
MIMi102680 gene
neXtProtiNX_P35611
OpenTargetsiENSG00000087274
PharmGKBiPA31

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3699 Eukaryota
COG0235 LUCA
GeneTreeiENSGT00940000158581
InParanoidiP35611
KOiK18622
OMAiFMLHSAI
OrthoDBi400524at2759
PhylomeDBiP35611
TreeFamiTF313003

Enzyme and pathway databases

ReactomeiR-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
R-HSA-381038 XBP1(S) activates chaperone genes
R-HSA-5223345 Miscellaneous transport and binding events
SIGNORiP35611

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADD1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ADD1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		118
PharosiP35611 Tbio

Protein Ontology

More...PROi		PR:P35611
RNActiP35611 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000087274 Expressed in fundus of stomach and 238 other tissues
ExpressionAtlasiP35611 baseline and differential
GenevisibleiP35611 HS

Family and domain databases

DisProtiDP00240
Gene3Di3.40.225.10, 1 hit
InterProiView protein in InterPro
IPR027766 ADD1
IPR001303 Aldolase_II/adducin_N
IPR036409 Aldolase_II/adducin_N_sf
PANTHERiPTHR10672:SF4 PTHR10672:SF4, 1 hit
PfamiView protein in Pfam
PF00596 Aldolase_II, 1 hit
SMARTiView protein in SMART
SM01007 Aldolase_II, 1 hit
SUPFAMiSSF53639 SSF53639, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADDA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35611
Secondary accession number(s): A2A3N8
, A2A3P0, B4DI79, D3DVR3, D3DVR4, D3DVR5, Q13734, Q14729, Q16156, Q86XM2, Q9UJB6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: December 1, 2000
Last modified: April 22, 2020
This is version 199 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again