Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sterol O-acyltransferase 1

Gene

SOAT1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the formation of fatty acid-cholesterol esters, which are less soluble in membranes than cholesterol. Plays a role in lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it may act as a ligase.

Catalytic activityi

Acyl-CoA + cholesterol = CoA + cholesterol ester.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei4601 Publication1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAcyltransferase, Transferase
Biological processCholesterol metabolism, Lipid metabolism, Steroid metabolism, Sterol metabolism

Enzyme and pathway databases

BRENDAi2.3.1.26 2681
ReactomeiR-HSA-8964038 LDL clearance
SIGNORiP35610

Chemistry databases

SwissLipidsiSLP:000000702

Names & Taxonomyi

Protein namesi
Recommended name:
Sterol O-acyltransferase 1 (EC:2.3.1.261 Publication)
Alternative name(s):
Acyl-coenzyme A:cholesterol acyltransferase 1
Short name:
ACAT-1
Cholesterol acyltransferase 1
Gene namesi
Name:SOAT1
Synonyms:ACACT, ACACT1, ACAT, ACAT1, SOAT, STAT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000057252.12
HGNCiHGNC:11177 SOAT1
MIMi102642 gene
neXtProtiNX_P35610

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 140CytoplasmicSequence analysisAdd BLAST140
Transmembranei141 – 159HelicalSequence analysisAdd BLAST19
Topological domaini160 – 181LumenalSequence analysisAdd BLAST22
Transmembranei182 – 201HelicalSequence analysisAdd BLAST20
Topological domaini202 – 224CytoplasmicSequence analysisAdd BLAST23
Transmembranei225 – 243HelicalSequence analysisAdd BLAST19
Topological domaini244 – 246LumenalSequence analysis3
Transmembranei247 – 264HelicalSequence analysisAdd BLAST18
Topological domaini265 – 501CytoplasmicSequence analysisAdd BLAST237
Transmembranei502 – 517HelicalSequence analysisAdd BLAST16
Topological domaini518 – 550LumenalSequence analysisAdd BLAST33

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi269S → A or T: Nearly normal expression and enzyme activity. 1 Publication1
Mutagenesisi269S → L: No expression nor activity. 1 Publication1
Mutagenesisi400D → N: Low expression, loss of enzymatic activity. 1 Publication1
Mutagenesisi456S → A: Loss of enzymatic activity. 1 Publication1
Mutagenesisi460H → A, C or N: Loss of enzymatic activity. 1 Publication1
Mutagenesisi518Y → F: Loss of enzymatic activity. 1 Publication1

Organism-specific databases

DisGeNETi6646
OpenTargetsiENSG00000057252
PharmGKBiPA36015

Chemistry databases

ChEMBLiCHEMBL2782
DrugBankiDB00973 Ezetimibe
DB01094 Hesperetin

Polymorphism and mutation databases

BioMutaiSOAT1
DMDMi33302623

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002076401 – 550Sterol O-acyltransferase 1Add BLAST550

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei8PhosphoserineCombined sources1
Disulfide bondi528 ↔ 5461 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Phosphoprotein

Proteomic databases

EPDiP35610
MaxQBiP35610
PaxDbiP35610
PeptideAtlasiP35610
PRIDEiP35610
ProteomicsDBi55101

PTM databases

iPTMnetiP35610
PhosphoSitePlusiP35610
SwissPalmiP35610

Expressioni

Inductioni

Highly activated by the presence of cholesterol.

Gene expression databases

BgeeiENSG00000057252 Expressed in 209 organ(s), highest expression level in adrenal tissue
CleanExiHS_ACAT1
HS_SOAT1
ExpressionAtlasiP35610 baseline and differential
GenevisibleiP35610 HS

Organism-specific databases

HPAiCAB009533
HPA047171

Interactioni

Subunit structurei

May form homo- or heterodimers. Interacts with UBIAD1.1 Publication

Binary interactionsi

Protein-protein interaction databases

BioGridi112529, 185 interactors
IntActiP35610, 150 interactors
MINTiP35610
STRINGi9606.ENSP00000356591

Chemistry databases

BindingDBiP35610

Structurei

3D structure databases

ProteinModelPortaliP35610
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0380 Eukaryota
COG5056 LUCA
GeneTreeiENSGT00530000063122
HOGENOMiHOG000020782
HOVERGENiHBG058198
InParanoidiP35610
KOiK00637
OMAiLFMCFGM
OrthoDBiEOG091G0991
PhylomeDBiP35610
TreeFamiTF105767

Family and domain databases

InterProiView protein in InterPro
IPR004299 MBOAT_fam
IPR014371 Oat_ACAT_DAG_ARE
IPR030687 Sterol_acyltranf_meta
PANTHERiPTHR10408 PTHR10408, 1 hit
PfamiView protein in Pfam
PF03062 MBOAT, 1 hit
PIRSFiPIRSF000439 Oat_ACAT_DAG_ARE, 1 hit
PIRSF500230 Sterol_acyltranf_ACAT, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: P35610-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVGEEKMSLR NRLSKSRENP EEDEDQRNPA KESLETPSNG RIDIKQLIAK
60 70 80 90 100
KIKLTAEAEE LKPFFMKEVG SHFDDFVTNL IEKSASLDNG GCALTTFSVL
110 120 130 140 150
EGEKNNHRAK DLRAPPEQGK IFIARRSLLD ELLEVDHIRT IYHMFIALLI
160 170 180 190 200
LFILSTLVVD YIDEGRLVLE FSLLSYAFGK FPTVVWTWWI MFLSTFSVPY
210 220 230 240 250
FLFQHWATGY SKSSHPLIRS LFHGFLFMIF QIGVLGFGPT YVVLAYTLPP
260 270 280 290 300
ASRFIIIFEQ IRFVMKAHSF VRENVPRVLN SAKEKSSTVP IPTVNQYLYF
310 320 330 340 350
LFAPTLIYRD SYPRNPTVRW GYVAMKFAQV FGCFFYVYYI FERLCAPLFR
360 370 380 390 400
NIKQEPFSAR VLVLCVFNSI LPGVLILFLT FFAFLHCWLN AFAEMLRFGD
410 420 430 440 450
RMFYKDWWNS TSYSNYYRTW NVVVHDWLYY YAYKDFLWFF SKRFKSAAML
460 470 480 490 500
AVFAVSAVVH EYALAVCLSF FYPVLFVLFM FFGMAFNFIV NDSRKKPIWN
510 520 530 540 550
VLMWTSLFLG NGVLLCFYSQ EWYARQHCPL KNPTFLDYVR PRSWTCRYVF
Length:550
Mass (Da):64,735
Last modified:July 25, 2003 - v3
Checksum:i5F5ACD525D541DEE
GO
Isoform 2 (identifier: P35610-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAE → M

Show »
Length:492
Mass (Da):58,131
Checksum:i285EF79CC80BF5E8
GO
Isoform 3 (identifier: P35610-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:485
Mass (Da):57,238
Checksum:i9C0D0F331D69376A
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1APM4B1APM4_HUMAN
Sterol O-acyltransferase 1
SOAT1
260Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052031526Q → R1 PublicationCorresponds to variant dbSNP:rs13306731Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0453301 – 65Missing in isoform 3. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_0453311 – 59MVGEE…TAEAE → M in isoform 2. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L21934 mRNA Translation: AAC37532.2
AK290659 mRNA Translation: BAF83348.1
AK300551 mRNA Translation: BAG62257.1
AL451075 Genomic DNA No translation available.
AL512326 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91043.1
CH471067 Genomic DNA Translation: EAW91044.1
BC028940 mRNA Translation: AAH28940.1
CCDSiCCDS1330.1 [P35610-1]
CCDS58047.1 [P35610-2]
CCDS58048.1 [P35610-3]
PIRiA59038 A48026
RefSeqiNP_001239440.1, NM_001252511.1 [P35610-2]
NP_001239441.1, NM_001252512.1 [P35610-3]
NP_003092.4, NM_003101.5 [P35610-1]
XP_011508213.1, XM_011509911.1 [P35610-1]
UniGeneiHs.445588

Genome annotation databases

EnsembliENST00000367619; ENSP00000356591; ENSG00000057252 [P35610-1]
ENST00000539888; ENSP00000441356; ENSG00000057252 [P35610-3]
ENST00000540564; ENSP00000445315; ENSG00000057252 [P35610-2]
GeneIDi6646
KEGGihsa:6646
UCSCiuc001gml.4 human [P35610-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSOAT1_HUMAN
AccessioniPrimary (citable) accession number: P35610
Secondary accession number(s): A6NC40
, A8K3P4, A9Z1V7, B4DU95, Q5T0X4, Q8N1E4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: July 25, 2003
Last modified: September 12, 2018
This is version 177 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again