Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 183 (08 May 2019)
Sequence version 3 (26 Jun 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sodium channel protein para

Gene

para

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Sodium channel, Voltage-gated channel
Biological processIon transport, Sodium transport, Transport
LigandSodium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium channel protein para
Alternative name(s):
Protein paralytic
Sodium channel 1
Short name:
DmNav1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:para
ORF Names:CG9907
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0285944 para

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 148CytoplasmicCuratedAdd BLAST148
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei149 – 172Helical; Name=S1 of repeat ISequence analysisAdd BLAST24
Topological domaini173 – 180ExtracellularCurated8
Transmembranei181 – 199Helical; Name=S2 of repeat ISequence analysisAdd BLAST19
Topological domaini200 – 212CytoplasmicCuratedAdd BLAST13
Transmembranei213 – 231Helical; Name=S3 of repeat ISequence analysisAdd BLAST19
Topological domaini232 – 237ExtracellularCurated6
Transmembranei238 – 257Helical; Voltage-sensor; Name=S4 of repeat ISequence analysisAdd BLAST20
Topological domaini258 – 273CytoplasmicCuratedAdd BLAST16
Transmembranei274 – 297Helical; Name=S5 of repeat ISequence analysisAdd BLAST24
Topological domaini298 – 373ExtracellularCuratedAdd BLAST76
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei374 – 398Pore-formingBy similarityAdd BLAST25
Topological domaini399 – 405ExtracellularCurated7
Transmembranei406 – 427Helical; Name=S6 of repeat ISequence analysisAdd BLAST22
Topological domaini428 – 812CytoplasmicCuratedAdd BLAST385
Transmembranei813 – 837Helical; Name=S1 of repeat IISequence analysisAdd BLAST25
Topological domaini838 – 848ExtracellularCuratedAdd BLAST11
Transmembranei849 – 873Helical; Name=S2 of repeat IISequence analysisAdd BLAST25
Topological domaini874 – 880CytoplasmicCurated7
Transmembranei881 – 900Helical; Name=S3 of repeat IISequence analysisAdd BLAST20
Topological domaini901 – 906ExtracellularCurated6
Transmembranei907 – 926Helical; Voltage-sensor; Name=S4 of repeat IISequence analysisAdd BLAST20
Topological domaini927 – 941CytoplasmicCuratedAdd BLAST15
Transmembranei942 – 963Helical; Name=S5 of repeat IISequence analysisAdd BLAST22
Topological domaini964 – 985ExtracellularCuratedAdd BLAST22
Intramembranei986 – 1006Pore-formingBy similarityAdd BLAST21
Topological domaini1007 – 1013ExtracellularCurated7
Transmembranei1014 – 1041Helical; Name=S6 of repeat IISequence analysisAdd BLAST28
Topological domaini1042 – 1296CytoplasmicCuratedAdd BLAST255
Transmembranei1297 – 1320Helical; Name=S1 of repeat IIISequence analysisAdd BLAST24
Topological domaini1321 – 1334ExtracellularCuratedAdd BLAST14
Transmembranei1335 – 1359Helical; Name=S2 of repeat IIISequence analysisAdd BLAST25
Topological domaini1360 – 1365CytoplasmicCurated6
Transmembranei1366 – 1387Helical; Name=S3 of repeat IIISequence analysisAdd BLAST22
Topological domaini1388 – 1391ExtracellularCurated4
Transmembranei1392 – 1413Helical; Voltage-sensor; Name=S4 of repeat IIISequence analysisAdd BLAST22
Topological domaini1414 – 1432CytoplasmicCuratedAdd BLAST19
Transmembranei1433 – 1454Helical; Name=S5 of repeat IIISequence analysisAdd BLAST22
Topological domaini1455 – 1495ExtracellularCuratedAdd BLAST41
Intramembranei1496 – 1517Pore-formingBy similarityAdd BLAST22
Topological domaini1518 – 1533ExtracellularCuratedAdd BLAST16
Transmembranei1534 – 1560Helical; Name=S6 of repeat IIISequence analysisAdd BLAST27
Topological domaini1561 – 1614CytoplasmicCuratedAdd BLAST54
Transmembranei1615 – 1638Helical; Name=S1 of repeat IVSequence analysisAdd BLAST24
Topological domaini1639 – 1649ExtracellularCuratedAdd BLAST11
Transmembranei1650 – 1673Helical; Name=S2 of repeat IVSequence analysisAdd BLAST24
Topological domaini1674 – 1679CytoplasmicCurated6
Transmembranei1680 – 1703Helical; Name=S3 of repeat IVSequence analysisAdd BLAST24
Topological domaini1704 – 1713ExtracellularCurated10
Transmembranei1714 – 1735Helical; Voltage-sensor; Name=S4 of repeat IVSequence analysisAdd BLAST22
Topological domaini1736 – 1750CytoplasmicCuratedAdd BLAST15
Transmembranei1751 – 1773Helical; Name=S5 of repeat IVSequence analysisAdd BLAST23
Topological domaini1774 – 1787ExtracellularCuratedAdd BLAST14
Intramembranei1788 – 1810Pore-formingBy similarityAdd BLAST23
Topological domaini1811 – 1835ExtracellularCuratedAdd BLAST25
Transmembranei1836 – 1860Helical; Name=S6 of repeat IVSequence analysisAdd BLAST25
Topological domaini1861 – 2131CytoplasmicCuratedAdd BLAST271

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000485151 – 2131Sodium channel protein paraAdd BLAST2131

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi301 ↔ 350By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi313N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi325N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi343N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei553Phosphoserine; by PKASequence analysis1
Modified residuei570Phosphoserine; by PKASequence analysis1
Glycosylationi982N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1008 ↔ 1016By similarity
Glycosylationi1463N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1482N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P35500

PRoteomics IDEntifications database

More...
PRIDEi
P35500

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform exonb and isoform D are seen in embryos and adults. Isoform A, isoform F24 and isoform F30 are predominant in embryos and isoform C and isoform E predominant in adults.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0264255 Expressed in 9 organ(s), highest expression level in head

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P35500 differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P35500 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
58957, 34 interactors

Protein interaction database and analysis system

More...
IntActi
P35500, 1 interactor

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0292707

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati134 – 467ICuratedAdd BLAST334
Repeati799 – 1069IICuratedAdd BLAST271
Repeati1284 – 1591IIICuratedAdd BLAST308
Repeati1601 – 1862IVCuratedAdd BLAST262
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1877 – 1912EF-handPROSITE-ProRule annotationAdd BLAST36

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The sequence contains 4 internal repeats, each with 5 hydrophobic segments (S1, S2, S3, S5, S6) and one positively charged segment (S4). Segments S4 are probably the voltage-sensors and are characterized by a series of positively charged amino acids at every third position.Curated

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2301 Eukaryota
ENOG410XNP6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000167131

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P35500

KEGG Orthology (KO)

More...
KOi
K04834

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P35500

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002048 EF_hand_dom
IPR005821 Ion_trans_dom
IPR001696 Na_channel_asu
IPR010526 Na_trans_assoc
IPR024583 Na_trans_cytopl
IPR027359 Volt_channel_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00520 Ion_trans, 4 hits
PF06512 Na_trans_assoc, 1 hit
PF11933 Na_trans_cytopl, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00170 NACHANNEL

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50222 EF_HAND_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Further isoforms have been identified but not yet sequenced. These have different combinations of the optional exons A, B, C, D, E and F. Isoforms always have either exon C or D as these encode segment S4. Sequence identity to para from D.virilis suggests there may also be optional exons H and I.

This entry has 9 described isoforms and 55 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: P35500-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTEDSDSISE EERSLFRPFT RESLVQIEQR IAAEHEKQKE LERKRAEGEV
60 70 80 90 100
PQYGRKKKQK EIRYDDEDED EGPQPDPTLE QGVPIPVRLQ GSFPPELAST
110 120 130 140 150
PLEDIDPYYS NVLTFVVVSK GKDIFRFSAS KAMWMLDPFN PIRRVAIYIL
160 170 180 190 200
VHPLFSLFII TTILVNCILM IMPTTPTVES TEVIFTGIYT FESAVKVMAR
210 220 230 240 250
GFILCPFTYL RDAWNWLDFV VIALAYVTMG IDLGNLAALR TFRVLRALKT
260 270 280 290 300
VAIVPGLKTI VGAVIESVKN LRDVIILTMF SLSVFALMGL QIYMGVLTQK
310 320 330 340 350
CIKKFPLDGS WGNLTDENWD YHNRNSSNWY SEDEGISFPL CGNISGAGQC
360 370 380 390 400
DDDYVCLQGF GPNPNYGYTS FDSFGWAFLS AFRLMTQDFW EDLYQLVLRA
410 420 430 440 450
AGPWHMLFFI VIIFLGSFYL VNLILAIVAM SYDELQKKAE EEEAAEEEAI
460 470 480 490 500
REAEEAAAAK AAKLEERANA QAQAAADAAA AEEAALHPEM AKSPTYSCIS
510 520 530 540 550
YELFVGGEKG NDDNNKEKMS IRSVEVESES VSVIQRQPAP TTAHQATKVR
560 570 580 590 600
KVSTTSLSLP GSPFNIRRGS RSSHKYTIRN GRGRFGIPGS DRKPLVLSTY
610 620 630 640 650
QDAQQHLPYA DDSNAVTPMS EENGAIIVPV YYGNLGSRHS SYTSHQSRIS
660 670 680 690 700
YTSHGDLLGG MAVMGVSTMT KESKLRNRNT RNQSVGATNG GTTCLDTNHK
710 720 730 740 750
LDHRDYEIGL ECTDEAGKIK HHDNPFIEPV QTQTVVDMKD VMVLNDIIEQ
760 770 780 790 800
AAGRHSRASD RGVSVYYFPT EDDDEDGPTF KDKALEVILK GIDVFCVWDC
810 820 830 840 850
CWVWLKFQEW VSLIVFDPFV ELFITLCIVV NTMFMAMDHH DMNKEMERVL
860 870 880 890 900
KSGNYFFTAT FAIEATMKLM AMSPKYYFQE GWNIFDFIIV ALSLLELGLE
910 920 930 940 950
GVQGLSVLRS FRLLRVFKLA KSWPTLNLLI SIMGRTMGAL GNLTFVLCII
960 970 980 990 1000
IFIFAVMGMQ LFGKNYHDHK DRFPDGDLPR WNFTDFMHSF MIVFRVLCGE
1010 1020 1030 1040 1050
WIESMWDCMY VGDVSCIPFF LATVVIGNLV VLNLFLALLL SNFGSSSLSA
1060 1070 1080 1090 1100
PTADNDTNKI AEAFNRIGRF KSWVKRNIAD CFKLIRNKLT NQISDQPSGE
1110 1120 1130 1140 1150
RTNQISWIWS EGKGVCRCIS AEHGDNELEL GHDEILADGL IKKGIKEQTQ
1160 1170 1180 1190 1200
LEVAIGDGME FTIHGDMKNN KPKKSKYLNN ATDDDTASIN SYGSHKNRPF
1210 1220 1230 1240 1250
KDESHKGSAE TMEGEEKRDA SKEDLGLDEE LDEEGECEEG PLDGDIIIHA
1260 1270 1280 1290 1300
HDEDILDEYP ADCCPDSYYK KFPILAGDDD SPFWQGWGNL RLKTFQLIEN
1310 1320 1330 1340 1350
KYFETAVITM ILMSSLALAL EDVHLPQRPI LQDILYYMDR IFTVIFFLEM
1360 1370 1380 1390 1400
LIKWLALGFK VYFTNAWCWL DFVIVMVSLI NFVASLVGAG GIQAFKTMRT
1410 1420 1430 1440 1450
LRALRPLRAM SRMQGMRVVV NALVQAIPSI FNVLLVCLIF WLIFAIMGVQ
1460 1470 1480 1490 1500
LFAGKYFKCE DMNGTKLSHE IIPNRNACES ENYTWVNSAM NFDHVGNAYL
1510 1520 1530 1540 1550
CLFQVATFKG WIQIMNDAID SREVDKQPIR ETNIYMYLYF VFFIIFGSFF
1560 1570 1580 1590 1600
TLNLFIGVII DNFNEQKKKA GGSLEMFMTE DQKKYYNAMK KMGSKKPLKA
1610 1620 1630 1640 1650
IPRPRWRPQA IVFEIVTDKK FDIIIMLFIG LNMFTMTLDR YDASDTYNAV
1660 1670 1680 1690 1700
LDYLNAIFVV IFSSECLLKI FALRYHYFIE PWNLFDVVVV ILSILGLVLS
1710 1720 1730 1740 1750
DIIEKYFVSP TLLRVVRVAK VGRVLRLVKG AKGIRTLLFA LAMSLPALFN
1760 1770 1780 1790 1800
ICLLLFLVMF IFAIFGMSFF MHVKEKSGIN DVYNFKTFGQ SMILLFQMST
1810 1820 1830 1840 1850
SAGWDGVLDA IINEEACDPP DNDKGYPGNC GSATVGITFL LSYLVISFLI
1860 1870 1880 1890 1900
VINMYIAVIL ENYSQATEDV QEGLTDDDYD MYYEIWQQFD PEGTQYIRYD
1910 1920 1930 1940 1950
QLSEFLDVLE PPLQIHKPNK YKIISMDIPI CRGDLMYCVD ILDALTKDFF
1960 1970 1980 1990 2000
ARKGNPIEET GEIGEIAARP DTEGYEPVSS TLWRQREEYC ARLIQHAWRK
2010 2020 2030 2040 2050
HKARGEGGGS FEPDTDHGDG GDPDAGDPAP DEATDGDAPA GGDGSVNGTA
2060 2070 2080 2090 2100
EGAADADESN VNSPGEDAAA AAAAAAAAAA AGTTTAGSPG AGSAGRQTAV
2110 2120 2130
LVESDGFVTK NGHKVVIHSR SPSITSRTAD V
Length:2,131
Mass (Da):239,362
Last modified:June 26, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD0B8AF6463EF4551
GO
Isoform B (identifier: P35500-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1377-1417: VSLINFVASL...RAMSRMQGMR → LSLINLAAVW...RAVSRWEGMK

Note: No experimental confirmation available.
Show »
Length:2,131
Mass (Da):239,468
Checksum:i4B75AA1590E6CAC8
GO
Isoform C (identifier: P35500-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     937-967: MGALGNLTFVLCIIIFIFAVMGMQLFGKNYH → VGALGNLTFVLCIIIFIFAVMGMQLFGKNYT

Show »
Length:2,131
Mass (Da):239,294
Checksum:iD31B68DD10858111
GO
Isoform D (identifier: P35500-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     555-575: Missing.

Show »
Length:2,110
Mass (Da):237,096
Checksum:iE53D9CC884E8C83A
GO
Isoform E (identifier: P35500-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1100-1112: Missing.

Show »
Length:2,118
Mass (Da):237,775
Checksum:i265ED41424689B16
GO
Isoform F24 (identifier: P35500-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1113-1122: Missing.

Show »
Length:2,121
Mass (Da):238,315
Checksum:i33829C75027E89DB
GO
Isoform F30 (identifier: P35500-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1115-1122: Missing.

Show »
Length:2,123
Mass (Da):238,500
Checksum:i6DCF6BBBBF6A7F35
GO
Isoform exonb (identifier: P35500-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     763-770: Missing.

Show »
Length:2,123
Mass (Da):238,405
Checksum:iC7BFB4A116D2684F
GO
Isoform exond (identifier: P35500-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     914-967: Missing.

Show »
Length:2,077
Mass (Da):233,277
Checksum:iE6AABA9550C305FD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 55 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X2JKQ0X2JKQ0_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,131Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z0Z2B7Z0Z2_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,114Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MS71M9MS71_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,092Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MSP9M9MSP9_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,062Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MS92M9MS92_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,143Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X2JFE8X2JFE8_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,055Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MSB4M9MSB4_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,087Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MSQ0M9MSQ0_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,066Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MSE6M9MSE6_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,132Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9MSP2M9MSP2_DROME
Sodium channel protein
para bas, bss, CG9907, Dmel\CG9907, DmNa[[V]]
2,100Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti52Q → R in AAB59190 (PubMed:2550145).Curated1
Sequence conflicti52Q → R in AAB59191 (PubMed:2550145).Curated1
Sequence conflicti52Q → R in AAB59193 (PubMed:2550145).Curated1
Sequence conflicti52Q → R in AAB59194 (PubMed:2550145).Curated1
Sequence conflicti52Q → R in AAB59195 (PubMed:2550145).Curated1
Sequence conflicti299Q → E in AAB59190 (PubMed:2550145).Curated1
Sequence conflicti299Q → E in AAB59191 (PubMed:2550145).Curated1
Sequence conflicti299Q → E in AAB59193 (PubMed:2550145).Curated1
Sequence conflicti299Q → E in AAB59194 (PubMed:2550145).Curated1
Sequence conflicti299Q → E in AAB59195 (PubMed:2550145).Curated1
Sequence conflicti304K → E in AAA98542 (PubMed:8182428).Curated1
Sequence conflicti437K → R in AAA98542 (PubMed:8182428).Curated1
Sequence conflicti437K → R in AAB59190 (PubMed:2550145).Curated1
Sequence conflicti437K → R in AAB59191 (PubMed:2550145).Curated1
Sequence conflicti437K → R in AAB59193 (PubMed:2550145).Curated1
Sequence conflicti437K → R in AAB59194 (PubMed:2550145).Curated1
Sequence conflicti437K → R in AAB59195 (PubMed:2550145).Curated1
Sequence conflicti452 – 454EAE → VSR in AAA98542 (PubMed:8182428).Curated3
Sequence conflicti1110 – 1111SE → TK in AAA98543 (PubMed:8182428).Curated2
Sequence conflicti1296Q → R in AAB59190 (PubMed:2550145).Curated1
Sequence conflicti1296Q → R in AAB59191 (PubMed:2550145).Curated1
Sequence conflicti1296Q → R in AAB59193 (PubMed:2550145).Curated1
Sequence conflicti1296Q → R in AAB59194 (PubMed:2550145).Curated1
Sequence conflicti1296Q → R in AAB59195 (PubMed:2550145).Curated1
Sequence conflicti1300N → D in AAB59190 (PubMed:2550145).Curated1
Sequence conflicti1300N → D in AAB59191 (PubMed:2550145).Curated1
Sequence conflicti1300N → D in AAB59193 (PubMed:2550145).Curated1
Sequence conflicti1300N → D in AAB59194 (PubMed:2550145).Curated1
Sequence conflicti1300N → D in AAB59195 (PubMed:2550145).Curated1
Sequence conflicti1363F → L in AAB59190 (PubMed:2550145).Curated1
Sequence conflicti1363F → L in AAB59191 (PubMed:2550145).Curated1
Sequence conflicti1363F → L in AAB59193 (PubMed:2550145).Curated1
Sequence conflicti1363F → L in AAB59194 (PubMed:2550145).Curated1
Sequence conflicti1363F → L in AAB59195 (PubMed:2550145).Curated1

<p>This subsection of the ‘Sequence’ section provides information relevant to all types of RNA editing events (conversion, insertion, deletion of nucleotides) that lead to one or more amino acid changes compared to the translation of the non-edited RNA version.<p><a href='/help/rna_editing' target='_top'>More...</a></p>RNA editingi

Edited at positions 471, 1455 and 1587.2 Publications
Partially edited. Further sites are edited by Adar. Positions 1455 and 1587 show minimal editing from embryos through to third larval instar, then a 40-fold increase at pupation. Position 471 has slightly higher levels during early development with only a four-fold increase at pupation.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti471Q → R in RNA edited version. 1
Natural varianti1455K → R in RNA edited version. 1
Natural varianti1587N → S in RNA edited version. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001035555 – 575Missing in isoform D. CuratedAdd BLAST21
Alternative sequenceiVSP_001036763 – 770Missing in isoform exonb. Curated8
Alternative sequenceiVSP_026199914 – 967Missing in isoform exond. CuratedAdd BLAST54
Alternative sequenceiVSP_001037937 – 967MGALG…GKNYH → VGALGNLTFVLCIIIFIFAV MGMQLFGKNYT in isoform C. CuratedAdd BLAST31
Alternative sequenceiVSP_0010381100 – 1112Missing in isoform E. CuratedAdd BLAST13
Alternative sequenceiVSP_0010391113 – 1122Missing in isoform F24. Curated10
Alternative sequenceiVSP_0010401115 – 1122Missing in isoform F30. Curated8
Alternative sequenceiVSP_0262001377 – 1417VSLIN…MQGMR → LSLINLAAVWSGADDVPAFR SMRTLRALRPLRAVSRWEGM K in isoform B. CuratedAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U26713 Genomic DNA Translation: AAA98541.1
U26714 Genomic DNA Translation: AAA98542.1
U26715 Genomic DNA Translation: AAA98543.1
U26716 Genomic DNA Translation: AAA98544.1
U26716 Genomic DNA Translation: AAA98545.1
U26716 Genomic DNA Translation: AAA98546.1
U26716 Genomic DNA Translation: AAA98547.1
U26716 Genomic DNA Translation: AAA98548.1
U26717 Genomic DNA Translation: AAA98549.1
AE014298 Genomic DNA Translation: AAF48617.2
AE014298 Genomic DNA Translation: ABI30985.1
AE014298 Genomic DNA Translation: ABI30986.1
M32078 Genomic DNA Translation: AAB59190.1
M32078 Genomic DNA Translation: AAB59191.1
M32078 Genomic DNA Translation: AAB59192.1
M32078 Genomic DNA Translation: AAB59193.1
M32078 Genomic DNA Translation: AAB59194.1
M32078 Genomic DNA Translation: AAB59195.1
AB008113 Genomic DNA Translation: BAA22890.1
AB035812 Genomic DNA Translation: BAA88526.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A30302
A33299

NCBI Reference Sequences

More...
RefSeqi
NP_001036280.1, NM_001042815.2 [P35500-8]
NP_001036281.1, NM_001042816.2 [P35500-4]
NP_001285332.1, NM_001298403.1 [P35500-1]
NP_523371.2, NM_078647.4 [P35500-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0074298; FBpp0074073; FBgn0285944 [P35500-1]
FBtr0111022; FBpp0110321; FBgn0285944 [P35500-8]
FBtr0111023; FBpp0110322; FBgn0285944 [P35500-4]
FBtr0303671; FBpp0292688; FBgn0285944 [P35500-5]
FBtr0342746; FBpp0309614; FBgn0285944 [P35500-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
32619

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG9907

UCSC genome browser

More...
UCSCi
CG9907-RA d. melanogaster [P35500-1]

Keywords - Coding sequence diversityi

Alternative splicing, RNA editing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26713 Genomic DNA Translation: AAA98541.1
U26714 Genomic DNA Translation: AAA98542.1
U26715 Genomic DNA Translation: AAA98543.1
U26716 Genomic DNA Translation: AAA98544.1
U26716 Genomic DNA Translation: AAA98545.1
U26716 Genomic DNA Translation: AAA98546.1
U26716 Genomic DNA Translation: AAA98547.1
U26716 Genomic DNA Translation: AAA98548.1
U26717 Genomic DNA Translation: AAA98549.1
AE014298 Genomic DNA Translation: AAF48617.2
AE014298 Genomic DNA Translation: ABI30985.1
AE014298 Genomic DNA Translation: ABI30986.1
M32078 Genomic DNA Translation: AAB59190.1
M32078 Genomic DNA Translation: AAB59191.1
M32078 Genomic DNA Translation: AAB59192.1
M32078 Genomic DNA Translation: AAB59193.1
M32078 Genomic DNA Translation: AAB59194.1
M32078 Genomic DNA Translation: AAB59195.1
AB008113 Genomic DNA Translation: BAA22890.1
AB035812 Genomic DNA Translation: BAA88526.1
PIRiA30302
A33299
RefSeqiNP_001036280.1, NM_001042815.2 [P35500-8]
NP_001036281.1, NM_001042816.2 [P35500-4]
NP_001285332.1, NM_001298403.1 [P35500-1]
NP_523371.2, NM_078647.4 [P35500-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi58957, 34 interactors
IntActiP35500, 1 interactor
STRINGi7227.FBpp0292707

Proteomic databases

PaxDbiP35500
PRIDEiP35500

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0074298; FBpp0074073; FBgn0285944 [P35500-1]
FBtr0111022; FBpp0110321; FBgn0285944 [P35500-8]
FBtr0111023; FBpp0110322; FBgn0285944 [P35500-4]
FBtr0303671; FBpp0292688; FBgn0285944 [P35500-5]
FBtr0342746; FBpp0309614; FBgn0285944 [P35500-1]
GeneIDi32619
KEGGidme:Dmel_CG9907
UCSCiCG9907-RA d. melanogaster [P35500-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
32619
FlyBaseiFBgn0285944 para

Phylogenomic databases

eggNOGiKOG2301 Eukaryota
ENOG410XNP6 LUCA
GeneTreeiENSGT00940000167131
InParanoidiP35500
KOiK04834
PhylomeDBiP35500

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Prm fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
32619

Protein Ontology

More...
PROi
PR:P35500

Gene expression databases

BgeeiFBgn0264255 Expressed in 9 organ(s), highest expression level in head
ExpressionAtlasiP35500 differential
GenevisibleiP35500 DM

Family and domain databases

Gene3Di1.20.120.350, 4 hits
InterProiView protein in InterPro
IPR002048 EF_hand_dom
IPR005821 Ion_trans_dom
IPR001696 Na_channel_asu
IPR010526 Na_trans_assoc
IPR024583 Na_trans_cytopl
IPR027359 Volt_channel_dom_sf
PfamiView protein in Pfam
PF00520 Ion_trans, 4 hits
PF06512 Na_trans_assoc, 1 hit
PF11933 Na_trans_cytopl, 1 hit
PRINTSiPR00170 NACHANNEL
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSCNA_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35500
Secondary accession number(s): O15994
, P92137, Q0KHR8, Q0KHR9, Q24082, Q24083, Q24084, Q24528, Q24529, Q24530, Q24531, Q24532, Q9VXF7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 26, 2007
Last modified: May 8, 2019
This is version 183 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again