Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor ROR-alpha

Gene

RORA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of embryonic development, cellular differentiation, immunity, circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target genes regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates genes involved in photoreceptor development including OPN1SW, OPN1SM and ARR3 and skeletal muscle development with MYOD1. Required for proper cerebellum development (PubMed:29656859). Regulates SHH gene expression, among others, to induce granule cells proliferation as well as expression of genes involved in calcium-mediated signal transduction. Regulates the circadian expression of several clock genes, including CLOCK, ARNTL/BMAL1, NPAS2 and CRY1. Competes with NR1D1 for binding to their shared DNA response element on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORA-mediated activation of clock genes expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Regulates genes involved in lipid metabolism such as apolipoproteins APOA1, APOA5, APOC3 and PPARG. In liver, has specific and redundant functions with RORC as positive or negative modulator of expression of genes encoding phase I and phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as CYP7B1 and SULT2A1. Induces a rhythmic expression of some of these genes. In addition, interplays functionally with NR1H2 and NR1H3 for the regulation of genes involved in cholesterol metabolism. Also involved in the regulation of hepatic glucose metabolism through the modulation of G6PC and PCK1. In adipose tissue, plays a role as negative regulator of adipocyte differentiation, probably acting through dual mechanisms. May suppress CEBPB-dependent adipogenesis through direct interaction and PPARG-dependent adipogenesis through competition for DNA-binding. Downstream of IL6 and TGFB and synergistically with RORC isoform 2, is implicated in the lineage specification of uncommitted CD4+ T-helper (T(H)) cells into T(H)17 cells, antagonizing the T(H)1 program. Probably regulates IL17 and IL17F expression on T(H) by binding to the essential enhancer conserved non-coding sequence 2 (CNS2) in the IL17-IL17F locus. Involved in hypoxia signaling by interacting with and activating the transcriptional activity of HIF1A. May inhibit cell growth in response to cellular stress. May exert an anti-inflammatory role by inducing CHUK expression and inhibiting NF-kappa-B signaling.19 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi73 – 138Nuclear receptorPROSITE-ProRule annotationAdd BLAST66
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri73 – 93NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri109 – 133NR C4-typePROSITE-ProRule annotationAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding, Receptor
Biological processBiological rhythms, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1368082 RORA activates gene expression
R-HSA-1989781 PPARA activates gene expression
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-400253 Circadian Clock
R-HSA-4090294 SUMOylation of intracellular receptors
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P35398

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P35398

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear receptor ROR-alpha
Alternative name(s):
Nuclear receptor RZR-alpha
Nuclear receptor subfamily 1 group F member 1
RAR-related orphan receptor A
Retinoid-related orphan receptor-alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RORA
Synonyms:NR1F1, RZRA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000069667.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10258 RORA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600825 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P35398

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Intellectual developmental disorder with or without epilepsy or cerebellar ataxia (IDDECA)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant neurodevelopmental disorder that manifests with variable features of mild-to-severe intellectual disability, developmental delay, autism spectrum disorder, cerebellar ataxia and epilepsy.
See also OMIM:618060
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08108990C → S in IDDECA; unknown pathological significance. 1 Publication1
Natural variantiVAR_08109092G → A in IDDECA; deleterious effect on embryonic development, when assayed in a heterologous system. 1 Publication1
Natural variantiVAR_08109194K → R in IDDECA; deleterious effect on embryonic development, when assayed in a heterologous system. 1 Publication1
Natural variantiVAR_081092409S → R in IDDECA. 1 Publication1
Natural variantiVAR_081093462R → Q in IDDECA; loss of function in cerebellar development, when assayed in a heterologous system. 1 Publication1
Natural variantiVAR_081095500 – 523Missing in IDDECA; unknown pathological significance. 1 PublicationAdd BLAST24

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi183T → A: Greatly increased transcriptional activity. Decrease in repression by NR1D1. 1 Publication1
Mutagenesisi183T → D or E: Some increase in transcriptional activity. No change in repression by NR1D1. 1 Publication1
Mutagenesisi183T → R: Attenuates transcriptional activity. 1 Publication1
Mutagenesisi183T → V or I: Some increase in transcriptional activity. 1 Publication1
Mutagenesisi240K → R: Loss of sumoylation. 1 Publication1
Mutagenesisi288C → Q: Less effect on transcriptional activity with cholesterol sulfate as substrate as compared to cholesterol as substrate. 1 Publication1
Mutagenesisi323C → L: About 60% loss of transcriptional activity. 2 Publications1
Mutagenesisi330A → L: About 80% loss of transcriptional activity. 2 Publications1
Mutagenesisi335V → R: Strongly decreases interaction with NCOA2 and MED1. 1 Publication1
Mutagenesisi339K → A: Complete loss of transcriptional activity; when associated with A-507. 1 Publication1
Mutagenesisi357K → A: Increased transcriptional activity. No effect on protein degradation. 1 Publication1
Mutagenesisi361L → F: Small reduction in transcriptional activity. No protein degradation. 1 Publication1
Mutagenesisi364V → G: Greatly reduced transcriptional activity. Protects from protein degradation. 1 Publication1
Mutagenesisi371A → Q: Almost total loss of transcriptional activity. 1 Publication1
Mutagenesisi399F → W: Slight loss of transcriptional activity. 1 Publication1
Mutagenesisi441K → R: No effect on sumoylation. 1 Publication1
Mutagenesisi484H → W: Almost total loss of transcriptional activity. 1 Publication1
Mutagenesisi507Y → A: Complete loss of transcriptional activity; when associated with A-339. 1 Publication1
Mutagenesisi507Y → F: About 40% loss of transcriptional activity. 1 Publication1
Mutagenesisi509E → K: Abolishes transcriptional activity. Protects from protein degradation. 2 Publications1
Mutagenesisi510 – 511LF → AA: Decreases interaction with NCOA2. Loss of interaction with FOXP3. 2 Publications2

Keywords - Diseasei

Disease mutation, Epilepsy, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
6095
MIMi618060 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000069667

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34630

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5868

Drug and drug target database

More...
DrugBanki
DB04540 Cholesterol
DB01990 Cholesterol-Sulfate

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
598

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RORA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
548814

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000535121 – 523Nuclear receptor ROR-alphaAdd BLAST523

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei38N6-methyllysine1 Publication1
Modified residuei183Phosphothreonine; by MAPK11 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki240Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by conventional PKCs in neurons inhibits transcriptional activity. Phosphorylated on Thr-183 by MAPK1/ERK1 in vitro.2 Publications
Sumoylated by SENP1 and SENP2. Sumoylation, promoted by PIAS2, PIAS3, PIAS4 but not PIAS1, enhances the transcriptional activity. Desumoylated by SENP1.1 Publication
Ubiquitinated, leading to its degradation by the proteasome. Proteasomal degradation is required for efficient transcriptional activity and is prevented by HR.1 Publication
Isoform 1: monomethylated at Lys-38 by EZH2, this creates a degron recognized by a DCX (DDB1-DCAF1/VPRBP-CUL4A-RBX1) E3 ubiquitin ligase complex.1 Publication

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P35398

PeptideAtlas

More...
PeptideAtlasi
P35398

PRoteomics IDEntifications database

More...
PRIDEi
P35398

ProteomicsDB human proteome resource

More...
ProteomicsDBi
55055
55056
55057 [P35398-3]
55058 [P35398-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P35398

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P35398

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in a number of tissues. Expressed in both regulatory T-cells (Treg) and effector T-cells (Teff) (PubMed:18354202, PubMed:7916608). Isoform 4: Highly expressed in the central nervous system, including in the cerebellum (PubMed:29656859).3 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Induced by oxidative stress and DNA damage. Isoform 4 is induced by hypoxia (through transactivation by HIF1A and SP1), but not isoform 1.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000069667 Expressed in 219 organ(s), highest expression level in lateral nuclear group of thalamus

CleanEx database of gene expression profiles

More...
CleanExi
HS_RORA

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P35398 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P35398 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009861

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Interacts (via the DNA-binding domain) with HIF1A; the interaction enhances HIF1A transcription under hypoxia through increasing protein stability. Interacts with CEBPB; the interaction disrupts the interaction CEBPB:EP300. Interacts with the coactivators NCOA2, PPARGC1A (via LXXLL motif), EP300 and MED1. Interacts with the corepressor NCOR1. Interacts with MAGED1 and CTNNB1. Interacts with CRY1 and PER2. Interacts (via AF-2 motif) with PROX1 (By similarity). Interacts with NRIP1. Isoform 4 interacts (via AF-2 motif) with isoform 1 of FOXP3 (via LXXLL motif).By similarity10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112022, 24 interactors

Database of interacting proteins

More...
DIPi
DIP-29938N

Protein interaction database and analysis system

More...
IntActi
P35398, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000261523

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P35398

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1523
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P35398

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P35398

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P35398

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini272 – 510NR LBDPROSITE-ProRule annotationAdd BLAST239

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi506 – 523AF-2Add BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi166 – 169Poly-Gln4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The AF-2 (activation function-2) motif is required for recruiting coregulators containing LXXLL motifs.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri73 – 93NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri109 – 133NR C4-typePROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4216 Eukaryota
ENOG410XUGR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157387

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000010200

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106848

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P35398

KEGG Orthology (KO)

More...
KOi
K08532

Identification of Orthologs from Complete Genome Data

More...
OMAi
YQNKPRE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0649

TreeFam database of animal gene trees

More...
TreeFami
TF319910

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR003079 ROR_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01293 RORNUCRECPTR
PR00398 STRDHORMONER
PR00047 STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48508 SSF48508, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P35398-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESAPAAPDP AASEPGSSGA DAAAGSRETP LNQESARKSE PPAPVRRQSY
60 70 80 90 100
SSTSRGISVT KKTHTSQIEI IPCKICGDKS SGIHYGVITC EGCKGFFRRS
110 120 130 140 150
QQSNATYSCP RQKNCLIDRT SRNRCQHCRL QKCLAVGMSR DAVKFGRMSK
160 170 180 190 200
KQRDSLYAEV QKHRMQQQQR DHQQQPGEAE PLTPTYNISA NGLTELHDDL
210 220 230 240 250
SNYIDGHTPE GSKADSAVSS FYLDIQPSPD QSGLDINGIK PEPICDYTPA
260 270 280 290 300
SGFFPYCSFT NGETSPTVSM AELEHLAQNI SKSHLETCQY LREELQQITW
310 320 330 340 350
QTFLQEEIEN YQNKQREVMW QLCAIKITEA IQYVVEFAKR IDGFMELCQN
360 370 380 390 400
DQIVLLKAGS LEVVFIRMCR AFDSQNNTVY FDGKYASPDV FKSLGCEDFI
410 420 430 440 450
SFVFEFGKSL CSMHLTEDEI ALFSAFVLMS ADRSWLQEKV KIEKLQQKIQ
460 470 480 490 500
LALQHVLQKN HREDGILTKL ICKVSTLRAL CGRHTEKLMA FKAIYPDIVR
510 520
LHFPPLYKEL FTSEFEPAMQ IDG
Length:523
Mass (Da):58,975
Last modified:April 16, 2014 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0FA43BBCE6E28DC7
GO
Isoform 2 (identifier: P35398-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MESAPAAPDP...ISVTKKTHTS → MNEGAPGDSD...KEVQTGYMNA

Note: Produced by alternative promoter usage. Region from 23 to 71 inhibits DNA-binding and transactivation activity.
Show »
Length:556
Mass (Da):63,036
Checksum:i0D9797A147CEE8AE
GO
Isoform 3 (identifier: P35398-3) [UniParc]FASTAAdd to basket
Also known as: Alpha-3

The sequence of this isoform differs from the canonical sequence as follows:
     38-65: KSEPPAPVRRQSYSSTSRGISVTKKTHT → SSSTCSSLSRLFWSQLEHINWDGATAKNFINLREFFSFLLPALRK

Note: Produced by alternative splicing.
Show »
Length:540
Mass (Da):61,108
Checksum:i89FEA2A06D25D971
GO
Isoform 4 (identifier: P35398-4) [UniParc]FASTAAdd to basket
Also known as: Alpha-4

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHT → MMYFVIAAMK

Note: Produced by alternative promoter usage.Curated
Show »
Length:468
Mass (Da):53,556
Checksum:iFD577090E6261B16
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DG53A0A0C4DG53_HUMAN
Nuclear receptor ROR-alpha
RORA
468Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DFP5A0A0C4DFP5_HUMAN
Nuclear receptor ROR-alpha
RORA hCG_1787044
548Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLS5H0YLS5_HUMAN
Nuclear receptor ROR-alpha
RORA
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YII6H0YII6_HUMAN
Nuclear receptor ROR-alpha
RORA
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X2G0A0A087X2G0_HUMAN
Nuclear receptor ROR-alpha
RORA
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti368M → V in AAA02963 (PubMed:7916608).Curated1
Sequence conflicti466I → M in AAA02963 (PubMed:7916608).Curated1
Isoform 4 (identifier: P35398-4)
Sequence conflicti7A → E in AAA02963 (PubMed:7916608).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08108990C → S in IDDECA; unknown pathological significance. 1 Publication1
Natural variantiVAR_08109092G → A in IDDECA; deleterious effect on embryonic development, when assayed in a heterologous system. 1 Publication1
Natural variantiVAR_08109194K → R in IDDECA; deleterious effect on embryonic development, when assayed in a heterologous system. 1 Publication1
Natural variantiVAR_081092409S → R in IDDECA. 1 Publication1
Natural variantiVAR_081093462R → Q in IDDECA; loss of function in cerebellar development, when assayed in a heterologous system. 1 Publication1
Natural variantiVAR_081094476T → A No effect on cerebellar development, when assayed in a heterologous system. 1 PublicationCorresponds to variant dbSNP:rs190933482Ensembl.1
Natural variantiVAR_081095500 – 523Missing in IDDECA; unknown pathological significance. 1 PublicationAdd BLAST24
Isoform 2 (identifier: P35398-1)
Natural varianti18P → S in a colorectal cancer sample, somatic mutation. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0539731 – 66MESAP…KTHTS → MNEGAPGDSDLETEARVPWS IMGHCLRTGQARMSATPTPA GEGARRDELFGILQILHQCI LSSGDAFVLTGVCCSWRQNG KPPYSQKEDKEVQTGYMNA in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_0539741 – 65MESAP…KKTHT → MMYFVIAAMK in isoform 4. 3 PublicationsAdd BLAST65
Alternative sequenceiVSP_05397538 – 65KSEPP…KKTHT → SSSTCSSLSRLFWSQLEHIN WDGATAKNFINLREFFSFLL PALRK in isoform 3. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U04897 mRNA Translation: AAA62658.1
U04898 mRNA Translation: AAA62659.1
U04899 mRNA Translation: AAA62660.1
L14611 mRNA Translation: AAA02963.1
HQ692818 mRNA Translation: ADZ17329.1
AC009560 Genomic DNA No translation available.
AC012404 Genomic DNA No translation available.
AC022898 Genomic DNA No translation available.
AC079068 Genomic DNA No translation available.
AC087385 Genomic DNA No translation available.
AC107241 Genomic DNA No translation available.
AC107905 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77594.1
BC008831 mRNA Translation: AAH08831.1
BC100987 mRNA Translation: AAI00988.1
BC100988 mRNA Translation: AAI00989.1
BC100989 mRNA Translation: AAI00990.1
BC100990 mRNA Translation: AAI00991.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10177.1 [P35398-2]
CCDS10179.1 [P35398-1]
CCDS45271.1 [P35398-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
A53196
A56856
B53196
C53196

NCBI Reference Sequences

More...
RefSeqi
NP_002934.1, NM_002943.3
NP_599022.1, NM_134260.2 [P35398-1]
NP_599023.1, NM_134261.2 [P35398-2]
NP_599024.1, NM_134262.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.560343

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261523; ENSP00000261523; ENSG00000069667 [P35398-1]
ENST00000335670; ENSP00000335087; ENSG00000069667 [P35398-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6095

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6095

UCSC genome browser

More...
UCSCi
uc002agt.5 human [P35398-2]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U04897 mRNA Translation: AAA62658.1
U04898 mRNA Translation: AAA62659.1
U04899 mRNA Translation: AAA62660.1
L14611 mRNA Translation: AAA02963.1
HQ692818 mRNA Translation: ADZ17329.1
AC009560 Genomic DNA No translation available.
AC012404 Genomic DNA No translation available.
AC022898 Genomic DNA No translation available.
AC079068 Genomic DNA No translation available.
AC087385 Genomic DNA No translation available.
AC107241 Genomic DNA No translation available.
AC107905 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77594.1
BC008831 mRNA Translation: AAH08831.1
BC100987 mRNA Translation: AAI00988.1
BC100988 mRNA Translation: AAI00989.1
BC100989 mRNA Translation: AAI00990.1
BC100990 mRNA Translation: AAI00991.1
CCDSiCCDS10177.1 [P35398-2]
CCDS10179.1 [P35398-1]
CCDS45271.1 [P35398-4]
PIRiA53196
A56856
B53196
C53196
RefSeqiNP_002934.1, NM_002943.3
NP_599022.1, NM_134260.2 [P35398-1]
NP_599023.1, NM_134261.2 [P35398-2]
NP_599024.1, NM_134262.2
UniGeneiHs.560343

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1N83X-ray1.63A271-523[»]
1S0XX-ray2.20A271-523[»]
4S15X-ray1.90A/B269-523[»]
ProteinModelPortaliP35398
SMRiP35398
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112022, 24 interactors
DIPiDIP-29938N
IntActiP35398, 9 interactors
STRINGi9606.ENSP00000261523

Chemistry databases

BindingDBiP35398
ChEMBLiCHEMBL5868
DrugBankiDB04540 Cholesterol
DB01990 Cholesterol-Sulfate
GuidetoPHARMACOLOGYi598

PTM databases

iPTMnetiP35398
PhosphoSitePlusiP35398

Polymorphism and mutation databases

BioMutaiRORA
DMDMi548814

Proteomic databases

PaxDbiP35398
PeptideAtlasiP35398
PRIDEiP35398
ProteomicsDBi55055
55056
55057 [P35398-3]
55058 [P35398-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261523; ENSP00000261523; ENSG00000069667 [P35398-1]
ENST00000335670; ENSP00000335087; ENSG00000069667 [P35398-2]
GeneIDi6095
KEGGihsa:6095
UCSCiuc002agt.5 human [P35398-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6095
DisGeNETi6095
EuPathDBiHostDB:ENSG00000069667.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RORA
HGNCiHGNC:10258 RORA
HPAiCAB009861
MIMi600825 gene
618060 phenotype
neXtProtiNX_P35398
OpenTargetsiENSG00000069667
PharmGKBiPA34630

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4216 Eukaryota
ENOG410XUGR LUCA
GeneTreeiENSGT00940000157387
HOGENOMiHOG000010200
HOVERGENiHBG106848
InParanoidiP35398
KOiK08532
OMAiYQNKPRE
OrthoDBiEOG091G0649
TreeFamiTF319910

Enzyme and pathway databases

ReactomeiR-HSA-1368082 RORA activates gene expression
R-HSA-1989781 PPARA activates gene expression
R-HSA-383280 Nuclear Receptor transcription pathway
R-HSA-400253 Circadian Clock
R-HSA-4090294 SUMOylation of intracellular receptors
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
SignaLinkiP35398
SIGNORiP35398

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RORA human
EvolutionaryTraceiP35398

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RAR-related_orphan_receptor_alpha

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6095

Protein Ontology

More...
PROi
PR:P35398

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000069667 Expressed in 219 organ(s), highest expression level in lateral nuclear group of thalamus
CleanExiHS_RORA
ExpressionAtlasiP35398 baseline and differential
GenevisibleiP35398 HS

Family and domain databases

Gene3Di3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR_like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR003079 ROR_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR01293 RORNUCRECPTR
PR00398 STRDHORMONER
PR00047 STROIDFINGER
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRORA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35398
Secondary accession number(s): P35397
, P35399, P45445, Q495X4, Q96H83
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: April 16, 2014
Last modified: December 5, 2018
This is version 195 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again