Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (02 Dec 2020)
Sequence version 1 (01 Jun 1994)
Previous versions | rss
Add a publicationFeedback
Protein

Follicle-stimulating hormone receptor

Gene

FSHR

Organism
Ovis aries (Sheep)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

G protein-coupled receptor for follitropin, the follicle-stimulating hormone. The activity of isoform FSH-R1 is mediated by G proteins which activate adenylate cyclase (PubMed:10527886, PubMed:9364440). Isoform FSH-R2 and isoform FSH-R3 also bind FSH, but this does not result in activation of adenylate cyclase (PubMed:10527886, PubMed:9364440). Isoform FSH-R3 may be involved in calcium signaling (PubMed:10527886). Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways (By similarity).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Follicle-stimulating hormone receptor
Short name:
FSH-R
Alternative name(s):
Follitropin receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FSHR
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiOvis aries (Sheep)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9940 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaArtiodactylaRuminantiaPecoraBovidaeCaprinaeOvis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002356 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini18 – 366ExtracellularSequence analysisAdd BLAST349
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei367 – 387Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini388 – 398CytoplasmicSequence analysisAdd BLAST11
Transmembranei399 – 421Helical; Name=2Sequence analysisAdd BLAST23
Topological domaini422 – 443ExtracellularSequence analysisAdd BLAST22
Transmembranei444 – 465Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini466 – 485CytoplasmicSequence analysisAdd BLAST20
Transmembranei486 – 508Helical; Name=4Sequence analysisAdd BLAST23
Topological domaini509 – 528ExtracellularSequence analysisAdd BLAST20
Transmembranei529 – 550Helical; Name=5Sequence analysisAdd BLAST22
Topological domaini551 – 573CytoplasmicSequence analysisAdd BLAST23
Transmembranei574 – 597Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini598 – 608ExtracellularSequence analysisAdd BLAST11
Transmembranei609 – 630Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini631 – 695CytoplasmicSequence analysisAdd BLAST65

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001277618 – 695Follicle-stimulating hormone receptorAdd BLAST678

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi18 ↔ 25PROSITE-ProRule annotation
Disulfide bondi23 ↔ 32PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi191N-linked (GlcNAc...) asparagineBy similarity1
Glycosylationi199N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi275 ↔ 346By similarity
Disulfide bondi276 ↔ 356By similarity
Disulfide bondi276 ↔ 292By similarity
Disulfide bondi292 ↔ 338By similarity
Glycosylationi293N-linked (GlcNAc...) asparagineBy similarity1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei335SulfotyrosineBy similarity1
Disulfide bondi442 ↔ 517PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated; indirectly required for FSH-binding, possibly via a conformational change that allows high affinity binding of hormone.By similarity
Sulfated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Sulfation

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform FSH-R3 is expressed in ovary and testis, but not in kidney (at protein level).1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer. Functions as a homotrimer binding the FSH hormone heterodimer composed of CGA and FSHB (By similarity).

Interacts with ARRB2 (By similarity).

Interacts with APPL2; interaction is independent of follicle stimulating hormone stimulation (By similarity).

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9940.ENSOARP00000004647

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P35379

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini18 – 46LRRNTAdd BLAST29
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati48 – 70LRR 1Add BLAST23
Repeati71 – 93LRR 2Add BLAST23
Repeati96 – 118LRR 3Add BLAST23
Repeati121 – 142LRR 4Add BLAST22
Repeati143 – 167LRR 5Add BLAST25
Repeati171 – 192LRR 6Add BLAST22
Repeati194 – 216LRR 7Add BLAST23
Repeati219 – 239LRR 8Add BLAST21
Repeati240 – 262LRR 9Add BLAST23

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. FSH/LSH/TSH subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2087, Eukaryota

Database of Orthologous Groups

More...
OrthoDBi
257031at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002272, FSH_rcpt
IPR024635, GnHR_TM
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM
IPR002131, Gphrmn_rcpt_fam
IPR026906, LRR_5
IPR000372, LRRNT

The PANTHER Classification System

More...
PANTHERi
PTHR24372:SF5, PTHR24372:SF5, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00001, 7tm_1, 1 hit
PF12369, GnHR_trans, 1 hit
PF13306, LRR_5, 2 hits
PF01462, LRRNT, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01143, FSHRECEPTOR
PR00373, GLYCHORMONER
PR00237, GPCRRHODOPSN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00013, LRRNT, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform FSH-R1 (identifier: P35379-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALFLVALLA FLSLGSGCHH RLCHCSNGVF LCQDSKVTEM PSDLPRDAVE
60 70 80 90 100
LRFVLTKLRV IPEGAFSGFG DLEKIEISQN DVLEVIEANV FSNLPKLHEI
110 120 130 140 150
RIEKANNLLY IDPDAFQNLP NLRYLLISNT GIKHLPAVHK IQSLQKVLLD
160 170 180 190 200
IQDNINIHTV ERNSFMGLSF ESMIVWLSKN GIQEIHNCAF NGTQLDELNL
210 220 230 240 250
SDNSNLEELP NDVFQGASGP VILDISRTRI RSLPSYGLEN LKKLRAKSTY
260 270 280 290 300
HLKKLPSLEK FVTLVEASLT YPSHCCAFAN WRRQTSDLHP ICNKSILRQE
310 320 330 340 350
VDDMTQARGQ RISLAEDDEP SYAKGFDMMY SEFDYDLCSE VVDVTCSPEP
360 370 380 390 400
DAFNPCEDIM GYDILRVLIW FISILAITGN ILVLVILITS QYKLTVPRFL
410 420 430 440 450
MCNLAFADLC IGIYLLLIAS VDVHTKSQYH NYAIDWQTGA GCDAAGFFTV
460 470 480 490 500
FASELSVYTL TAITLERWHT ITHAMQLECK VHVRHAASIM LVGWVFAFAV
510 520 530 540 550
ALFPIFGISS YMKVSICLPM DIDSPLSQLY VMSLLVLNVL AFVVICGCYT
560 570 580 590 600
HIYLTVRNPN ITSSSSDTKI AKRMAMLIFT DFLCMAPISF FAISASLKVP
610 620 630 640 650
LITVSKSKIL LVLFYPINSC ANPFLYAIFT RNFRRDFFIL LSKFGCYEVQ
660 670 680 690
AQTYRSETSF TAHNFHPRNG HCPPAPRVTN GSNYTLIPLR HLAKN
Length:695
Mass (Da):78,238
Last modified:June 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFBF75D89D88C0D4B
GO
Isoform FSH-R2 (identifier: P35379-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     643-670: KFGCYEVQAQTYRSETSFTAHNFHPRNG → LHCCTVGLICNHFSSLFVARGNIFLNLD
     671-695: Missing.

Show »
Length:670
Mass (Da):75,317
Checksum:i9FEAD18E4ECA3552
GO
Isoform FSH-R3 (identifier: P35379-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     224-259: DISRTRIRSLPSYGLENLKKLRAKSTYHLKKLPSLE → SPLLHCWAHLQSFFFVVCGQREHISEFGLKSKQHPN
     260-695: Missing.

Show »
Length:259
Mass (Da):29,095
Checksum:i9900308384BE90B9
GO
Isoform FSH-R4 (identifier: P35379-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-133: LISNTGIK → FKRWRNRI
     135-695: Missing.

Show »
Length:134
Mass (Da):15,336
Checksum:i668AC3E0CCF399F6
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001955126 – 133LISNTGIK → FKRWRNRI in isoform FSH-R4. 1 Publication8
Alternative sequenceiVSP_001956135 – 695Missing in isoform FSH-R4. 1 PublicationAdd BLAST561
Alternative sequenceiVSP_001957224 – 259DISRT…LPSLE → SPLLHCWAHLQSFFFVVCGQ REHISEFGLKSKQHPN in isoform FSH-R3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_001958260 – 695Missing in isoform FSH-R3. 1 PublicationAdd BLAST436
Alternative sequenceiVSP_001959643 – 670KFGCY…HPRNG → LHCCTVGLICNHFSSLFVAR GNIFLNLD in isoform FSH-R2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_001960671 – 695Missing in isoform FSH-R2. 1 PublicationAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L07302 mRNA Translation: AAA31525.1
L12766 mRNA Translation: AAA31523.1
L12767 mRNA Translation: AAA31524.1
L36115 mRNA Translation: AAK70667.1
AJ131735 Genomic DNA Translation: CAA10495.1
AF090438 Genomic DNA Translation: AAC61749.1

Protein sequence database of the Protein Information Resource

More...
PIRi
JC1493

NCBI Reference Sequences

More...
RefSeqi
NP_001009289.1, NM_001009289.1 [P35379-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
443299

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
oas:443299

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L07302 mRNA Translation: AAA31525.1
L12766 mRNA Translation: AAA31523.1
L12767 mRNA Translation: AAA31524.1
L36115 mRNA Translation: AAK70667.1
AJ131735 Genomic DNA Translation: CAA10495.1
AF090438 Genomic DNA Translation: AAC61749.1
PIRiJC1493
RefSeqiNP_001009289.1, NM_001009289.1 [P35379-1]

3D structure databases

SMRiP35379
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9940.ENSOARP00000004647

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

Genome annotation databases

GeneIDi443299
KEGGioas:443299

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2492

Phylogenomic databases

eggNOGiKOG2087, Eukaryota
OrthoDBi257031at2759

Family and domain databases

InterProiView protein in InterPro
IPR002272, FSH_rcpt
IPR024635, GnHR_TM
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM
IPR002131, Gphrmn_rcpt_fam
IPR026906, LRR_5
IPR000372, LRRNT
PANTHERiPTHR24372:SF5, PTHR24372:SF5, 1 hit
PfamiView protein in Pfam
PF00001, 7tm_1, 1 hit
PF12369, GnHR_trans, 1 hit
PF13306, LRR_5, 2 hits
PF01462, LRRNT, 1 hit
PRINTSiPR01143, FSHRECEPTOR
PR00373, GLYCHORMONER
PR00237, GPCRRHODOPSN
SMARTiView protein in SMART
SM00013, LRRNT, 1 hit
PROSITEiView protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFSHR_SHEEP
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35379
Secondary accession number(s): Q28573, Q28574, Q9TSI9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 1, 1994
Last modified: December 2, 2020
This is version 134 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again