Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P35372 (OPRM_HUMAN)

Entry version 195 (13 Nov 2019)
Sequence version 2 (15 Jul 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Mu-type opioid receptor

Gene

OPRM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for endogenous opioids such as beta-endorphin and endomorphin. Receptor for natural and synthetic opioids including morphine, heroin, DAMGO, fentanyl, etorphine, buprenorphin and methadone (PubMed:7905839, PubMed:7957926, PubMed:7891175, PubMed:12589820, PubMed:9689128). Agonist binding to the receptor induces coupling to an inactive GDP-bound heterotrimeric G-protein complex and subsequent exchange of GDP for GTP in the G-protein alpha subunit leading to dissociation of the G-protein complex with the free GTP-bound G-protein alpha and the G-protein beta-gamma dimer activating downstream cellular effectors (PubMed:7905839). The agonist- and cell type-specific activity is predominantly coupled to pertussis toxin-sensitive G(i) and G(o) G alpha proteins, GNAI1, GNAI2, GNAI3 and GNAO1 isoforms Alpha-1 and Alpha-2, and to a lesser extent to pertussis toxin-insensitive G alpha proteins GNAZ and GNA15 (PubMed:12068084). They mediate an array of downstream cellular responses, including inhibition of adenylate cyclase activity and both N-type and L-type calcium channels, activation of inward rectifying potassium channels, mitogen-activated protein kinase (MAPK), phospholipase C (PLC), phosphoinositide/protein kinase (PKC), phosphoinositide 3-kinase (PI3K) and regulation of NF-kappa-B. Also couples to adenylate cyclase stimulatory G alpha proteins. The selective temporal coupling to G-proteins and subsequent signaling can be regulated by RGSZ proteins, such as RGS9, RGS17 and RGS4. Phosphorylation by members of the GPRK subfamily of Ser/Thr protein kinases and association with beta-arrestins is involved in short-term receptor desensitization. Beta-arrestins associate with the GPRK-phosphorylated receptor and uncouple it from the G-protein thus terminating signal transduction. The phosphorylated receptor is internalized through endocytosis via clathrin-coated pits which involves beta-arrestins. The activation of the ERK pathway occurs either in a G-protein-dependent or a beta-arrestin-dependent manner and is regulated by agonist-specific receptor phosphorylation. Acts as a class A G-protein coupled receptor (GPCR) which dissociates from beta-arrestin at or near the plasma membrane and undergoes rapid recycling. Receptor down-regulation pathways are varying with the agonist and occur dependent or independent of G-protein coupling. Endogenous ligands induce rapid desensitization, endocytosis and recycling whereas morphine induces only low desensitization and endocytosis. Heterooligomerization with other GPCRs can modulate agonist binding, signaling and trafficking properties. Involved in neurogenesis. Isoform 12 couples to GNAS and is proposed to be involved in excitatory effects (PubMed:20525224). Isoform 16 and isoform 17 do not bind agonists but may act through oligomerization with binding-competent OPRM1 isoforms and reduce their ligand binding activity (PubMed:16580639).2 PublicationsBy similarity9 Publications

Miscellaneous

OPRM1 is the main physiological target for most clinically important opioid analgesics. OPRM1-mediated inhibition of voltage-gated calcium channels on central presynaptic terminals of primary afferent nociceptors is thought to be one of the primary mechanisms mediating analgesia at the spinal level. Opioid-induced hyperalgesic responses are observed following both acute and chronic dosing associated with cellular excitation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-111885 Opioid Signalling
R-HSA-202040 G-protein activation
R-HSA-375276 Peptide ligand-binding receptors
R-HSA-418594 G alpha (i) signalling events
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
R-HSA-9022699 MECP2 regulates neuronal receptors and channels

SIGNOR Signaling Network Open Resource

More...SIGNORi		P35372

Protein family/group databases

Transport Classification Database

More...TCDBi		9.A.14.13.18 the g-protein-coupled receptor (gpcr) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mu-type opioid receptor
Short name:
M-OR-1
Short name:
MOR-1
Alternative name(s):
Mu opiate receptor
Mu opioid receptor
Short name:
MOP
Short name:
hMOP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:OPRM1
Synonyms:MOR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8156 OPRM1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600018 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P35372

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 68ExtracellularBy similarityAdd BLAST68
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei69 – 93Helical; Name=1By similarityAdd BLAST25
Topological domaini94 – 106CytoplasmicBy similarityAdd BLAST13
Transmembranei107 – 131Helical; Name=2By similarityAdd BLAST25
Topological domaini132 – 142ExtracellularBy similarityAdd BLAST11
Transmembranei143 – 165Helical; Name=3By similarityAdd BLAST23
Topological domaini166 – 185CytoplasmicBy similarityAdd BLAST20
Transmembranei186 – 207Helical; Name=4By similarityAdd BLAST22
Topological domaini208 – 230ExtracellularBy similarityAdd BLAST23
Transmembranei231 – 255Helical; Name=5By similarityAdd BLAST25
Topological domaini256 – 279CytoplasmicBy similarityAdd BLAST24
Transmembranei280 – 306Helical; Name=6By similarityAdd BLAST27
Topological domaini307 – 314ExtracellularBy similarity8
Transmembranei315 – 338Helical; Name=7By similarityAdd BLAST24
Topological domaini339 – 400CytoplasmicBy similarityAdd BLAST62

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi142C → A or S: Abolishes ligand binding; when associated with A-219 or S-219. 1 Publication1
Mutagenesisi219C → A or S: Abolishes ligand binding; when associated with A-142 or S-142. 1 Publication1
Mutagenesisi273K → A: Impairs interaction with calmodulin. 2 Publications1
Mutagenesisi275R → A: Impairs interaction with calmodulin. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		4988

Open Targets

More...OpenTargetsi		ENSG00000112038

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31945

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P35372

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL233

Drug and drug target database

More...DrugBanki		DB01571 3-Methylfentanyl
DB01439 3-Methylthiofentanyl
DB00802 Alfentanil
DB06274 Alvimopan
DB00321 Amitriptyline
DB00913 Anileridine
DB00921 Buprenorphine
DB00611 Butorphanol
DB09061 Cannabidiol
DB01535 Carfentanil
DB00318 Codeine
DB00514 Dextromethorphan
DB00647 Dextropropoxyphene
DB01209 Dezocine
DB01452 Diamorphine
DB01565 Dihydromorphine
DB01444 Dimethylthiambutene
DB01081 Diphenoxylate
DB01548 Diprenorphine
DB09272 Eluxadoline
DB05492 Epicept NP-1
DB01466 Ethylmorphine
DB01497 Etorphine
DB00813 Fentanyl
DB00956 Hydrocodone
DB00327 Hydromorphone
DB01221 Ketamine
DB06738 Ketobemidone
DB01227 Levacetylmethadol
DB00504 Levallorphan
DB00854 Levorphanol
DB05509 LI-301
DB00836 Loperamide
DB14146 Loxicodegol
DB14009 Medical Cannabis
DB00454 Meperidine
DB00333 Methadone
DB01433 Methadyl acetate
DB06800 Methylnaltrexone
DB00295 Morphine
DB06409 Morphine glucuronide
DB14011 Nabiximols
DB00844 Nalbuphine
DB11691 Naldemedine
DB06230 Nalmefene
DB09049 Naloxegol
DB01183 Naloxone
DB00704 Naltrexone
DB00904 Ondansetron
DB11130 Opium
DB00497 Oxycodone
DB01192 Oxymorphone
DB00652 Pentazocine
DB11186 Pentoxyverine
DB09209 Pholcodine
DB00899 Remifentanil
DB00708 Sufentanil
DB06204 Tapentadol
DB09289 Tianeptine
DB00193 Tramadol
DB09089 Trimebutine
DB05046 V1003

DrugCentral

More...DrugCentrali		P35372

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		319

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		OPRM1

Domain mapping of disease mutations (DMDM)

More...DMDMi		2851402

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000699721 – 400Mu-type opioid receptorAdd BLAST400

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi9N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi12N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi40N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi48N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi142 ↔ 219PROSITE-ProRule annotation
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei168PhosphotyrosineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi353S-palmitoyl cysteineSequence analysis1
Modified residuei365PhosphoserineBy similarity1
Modified residuei372PhosphothreonineBy similarity1
Modified residuei377PhosphoserineBy similarity1
Modified residuei396PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Differentially phosphorylated in basal and agonist-induced conditions. Agonist-mediated phosphorylation modulates receptor internalization. Phosphorylated by GRK2 in a agonist-dependent manner. Phosphorylation at Tyr-168 requires receptor activation, is dependent on non-receptor protein tyrosine kinase Src and results in a decrease in agonist efficacy by reducing G-protein coupling efficiency. Phosphorylated on tyrosine residues; the phosphorylation is involved in agonist-induced G-protein-independent receptor down-regulation. Phosphorylation at Ser-377 is involved in G-protein-dependent but not beta-arrestin-dependent activation of the ERK pathway (By similarity).By similarity
Ubiquitinated. A basal ubiquitination seems not to be related to degradation. Ubiquitination is increased upon formation of OPRM1:OPRD1 oligomers leading to proteasomal degradation; the ubiquitination is diminished by RTP4.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P35372

PeptideAtlas

More...PeptideAtlasi		P35372

PRoteomics IDEntifications database

More...PRIDEi		P35372

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		18945
55038 [P35372-1]
55039 [P35372-10]
55040 [P35372-11]
55041 [P35372-12]
55042 [P35372-13]
55043 [P35372-14]
55044 [P35372-15]
55045 [P35372-16]
55046 [P35372-17]
55047 [P35372-2]
55048 [P35372-3]
55049 [P35372-4]
55050 [P35372-5]
55051 [P35372-6]
55052 [P35372-7]
55053 [P35372-8]
55054 [P35372-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P35372

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P35372

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P35372

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain. Isoform 16 and isoform 17 are detected in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000112038 Expressed in 36 organ(s), highest expression level in right hemisphere of cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P35372 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P35372 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA014509
HPA067435

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms homooligomers and heterooligomers with other GPCRs, such as OPRD1, OPRK1, OPRL1, NPFFR2, ADRA2A, SSTR2, CNR1 and CCR5 (probably in dimeric forms) (PubMed:12413885, PubMed:15778451, PubMed:15967873, PubMed:17224450).

Interacts with heterotrimeric G proteins; interaction with a heterotrimeric complex containing GNAI1, GNB1 and GNG2 stabilizes the active conformation of the receptor and increases its affinity for endomorphin-2, the synthetic opioid peptide DAMGO and for morphinan agonists (By similarity).

Interacts with PPL; the interaction disrupts agonist-mediated G-protein activation (PubMed:12810704).

Interacts (via C-terminus) with DNAJB4 (via C-terminus) (PubMed:16542645).

Interacts with calmodulin; the interaction inhibits the constitutive activity of OPRM1; it abolishes basal and attenuates agonist-stimulated G-protein coupling (PubMed:10419536, PubMed:10899953).

Interacts with FLNA, PLD2, RANBP9 and WLS and GPM6A (PubMed:12519790, PubMed:14573758, PubMed:19788913, PubMed:20214800).

Interacts with RTP4 (By similarity).

Interacts with SYP and GNAS (By similarity).

Interacts with RGS9, RGS17, RGS20, RGS4, PPP1R9B and HINT1 (By similarity).

By similarity12 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111033, 79 interactors

Protein interaction database and analysis system

More...IntActi		P35372, 125 interactors

Molecular INTeraction database

More...MINTi		P35372

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000394624

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P35372

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P35372

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi334 – 338NPxxY; plays a role in stabilizing the activated conformation of the receptorBy similarity5

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3656 Eukaryota
ENOG410XRW9 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158236

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000230486

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P35372

KEGG Orthology (KO)

More...KOi		K04215

Identification of Orthologs from Complete Genome Data

More...OMAi		PAWYWEN

Database of Orthologous Groups

More...OrthoDBi		1011272at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P35372

TreeFam database of animal gene trees

More...TreeFami		TF315737

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR000105 Mu_opioid_rcpt
IPR001418 Opioid_rcpt

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00237 GPCRRHODOPSN
PR00537 MUOPIOIDR
PR00384 OPIOIDR

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (18+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 18 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 18 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P35372-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSSAAPTNA SNCTDALAYS SCSPAPSPGS WVNLSHLDGN LSDPCGPNRT 
        60         70         80         90        100
DLGGRDSLCP PTGSPSMITA ITIMALYSIV CVVGLFGNFL VMYVIVRYTK 
       110        120        130        140        150
MKTATNIYIF NLALADALAT STLPFQSVNY LMGTWPFGTI LCKIVISIDY 
       160        170        180        190        200
YNMFTSIFTL CTMSVDRYIA VCHPVKALDF RTPRNAKIIN VCNWILSSAI 
       210        220        230        240        250
GLPVMFMATT KYRQGSIDCT LTFSHPTWYW ENLLKICVFI FAFIMPVLII 
       260        270        280        290        300
TVCYGLMILR LKSVRMLSGS KEKDRNLRRI TRMVLVVVAV FIVCWTPIHI 
       310        320        330        340        350
YVIIKALVTI PETTFQTVSW HFCIALGYTN SCLNPVLYAF LDENFKRCFR 
       360        370        380        390        400
EFCIPTSSNI EQQNSTRIRQ NTRDHPSTAN TVDRTNHQLE NLEAETAPLP
Length:400
Mass (Da):44,779
Last modified:July 15, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1DABEBEC9AFF6F66
GO
Isoform 2 (identifier: P35372-2) [UniParc]FASTAAdd to basket
Also known as: MOR1A, MOR-1A

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → VRSL

Show »
Length:392
Mass (Da):43,957
Checksum:i14184C69F06AFCBE
GO
Isoform 3 (identifier: P35372-3) [UniParc]FASTAAdd to basket
Also known as: MOR-1R, MOR-1X

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → CLPIPSLSCWALEQGCLVVYPGPLQGPLVRYDLPAILHSSCLRGNTAPSPSGGAFLLS

Show »
Length:446
Mass (Da):49,520
Checksum:i42DC76968E6352A8
GO
Isoform 4 (identifier: P35372-4) [UniParc]FASTAAdd to basket
Also known as: MOR-1B3

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → GPPAKFVADQLAGSS

Show »
Length:403
Mass (Da):44,928
Checksum:iB3FFA10F7B1C5311
GO
Isoform 5 (identifier: P35372-5) [UniParc]FASTAAdd to basket
Also known as: MOR-1C, MOR-1O

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → PPLAVSMAQIFTRYPPPTHREKTCNDYMKR

Show »
Length:418
Mass (Da):47,032
Checksum:i51B9E7B131122196
GO
Isoform 6 (identifier: P35372-6) [UniParc]FASTAAdd to basket
Also known as: MOR-1V, MOR-1Y, MOR-1Y2, MOR-1Y3

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → IRDPISNLPRVSVF

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:402
Mass (Da):45,096
Checksum:i5BC8380AB8196D70
GO
Isoform 7 (identifier: P35372-7) [UniParc]FASTAAdd to basket
Also known as: MOR-1B1

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → KIDLFQKSSLLNCEHTKG

Show »
Length:406
Mass (Da):45,544
Checksum:i1A0330578A82B183
GO
Isoform 8 (identifier: P35372-8) [UniParc]FASTAAdd to basket
Also known as: MOR-1B2

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → RERRQKSDW

Show »
Length:397
Mass (Da):44,743
Checksum:i3BC7E1C19B9739E3
GO
Isoform 9 (identifier: P35372-9) [UniParc]FASTAAdd to basket
Also known as: MOR-1B5

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → VELNLDCHCENAKPWPLSYNAGQSPFPFPGRV

Show »
Length:420
Mass (Da):47,070
Checksum:i63301322222198DE
GO
Isoform 10 (identifier: P35372-10) [UniParc]FASTAAdd to basket
Also known as: MOR-1i

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCLHRRVPSE...SGARPAVSTM

Show »
Length:493
Mass (Da):55,045
Checksum:i14A90F782A013067
GO
Isoform 11 (identifier: P35372-11) [UniParc]FASTAAdd to basket
Also known as: MOR-1B4

The sequence of this isoform differs from the canonical sequence as follows:
     389-400: LENLEAETAPLP → S

Show »
Length:389
Mass (Da):43,588
Checksum:i7E806AFCBE572CD5
GO
Isoform 12 (identifier: P35372-12) [UniParc]FASTAAdd to basket
Also known as: MOR-1G1, MOR-1K

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.

Show »
Length:300
Mass (Da):34,393
Checksum:i03FE8402349A629C
GO
Isoform 13 (identifier: P35372-13) [UniParc]FASTAAdd to basket
Also known as: MOR-1G2

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: MDSSAAPTNA...GNFLVMYVIV → MMRAKSISTKAGKPS

Show »
Length:319
Mass (Da):36,516
Checksum:i6373C1D800FF5E53
GO
Isoform 14 (identifier: P35372-14) [UniParc]FASTAAdd to basket
Also known as: Mu3

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     389-400: LENLEAETAPLP → NYYIIHRCCCNTPLISQKPVLLWFCD

Show »
Length:314
Mass (Da):36,240
Checksum:i7346DB61E594896E
GO
Isoform 15 (identifier: P35372-15) [UniParc]FASTAAdd to basket
Also known as: MOR-1W

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     389-400: LENLEAETAPLP → VRSL

Show »
Length:292
Mass (Da):33,570
Checksum:i62A80E8005705E4C
GO
Isoform 16 (identifier: P35372-16) [UniParc]FASTAAdd to basket
Also known as: SV1

The sequence of this isoform differs from the canonical sequence as follows:
     98-400: YTKMKTATNI...NLEAETAPLP → YSWFVIGGPEGRRKQRRLGEDKRARGCGEKG

Show »
Length:128
Mass (Da):13,544
Checksum:i1E780EE294726795
GO
Isoform 17 (identifier: P35372-17) [UniParc]FASTAAdd to basket
Also known as: SV2

The sequence of this isoform differs from the canonical sequence as follows:
     97-400: RYTKMKTATN...NLEAETAPLP → SSSWF

Show »
Length:101
Mass (Da):10,451
Checksum:iE6590D98EDF64171
GO
Isoform 18 (identifier: P35372-18) [UniParc]FASTAAdd to basket
Also known as: hMOR-1Z

The sequence of this isoform differs from the canonical sequence as follows:
     98-186: YTKMKTATNI...ALDFRTPRNA → FHRLYTNILS...LDSHSHLRHH
     187-400: Missing.

Show »
Length:186
Mass (Da):20,188
Checksum:i2A80DD5FADA6B83B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
L0E130L0E130_HUMAN
Micro opioid receptor isoform hMOR-...
OPRM1
476Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EW71E7EW71_HUMAN
Mu-type opioid receptor
OPRM1
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Isoform 9 : The sequence AAQ77392 differs from that shown. a polymorphism leading to premature termination of translation (position: 411:Q->Stop)Curated
The sequence EAW47705 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti26P → L in BAG36624 (PubMed:14702039).Curated1
Sequence conflicti51D → N in AAA20580 (PubMed:7905839).Curated1
Sequence conflicti109I → V in AAQ77391 (PubMed:15893644).Curated1
Sequence conflicti207M → I in AAB60354 (PubMed:7957926).Curated1
Sequence conflicti234L → V in AAA20580 (PubMed:7905839).Curated1
Isoform 3 (identifier: P35372-3)
Sequence conflicti402Q → H in AAK74189 (PubMed:12589820).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Variant Asp-40 does not show altered binding affinities for most opioid peptides and alkaloids tested, but it binds beta-endorphin, an endogenous opioid that activates the mu opioid receptor, approximately 3 times more tightly than the most common allelic form.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0095256A → V4 PublicationsCorresponds to variant dbSNP:rs1799972Ensembl.1
Natural variantiVAR_00952440N → D4 PublicationsCorresponds to variant dbSNP:rs1799971EnsemblClinVar.1
Natural variantiVAR_04942663G → V. Corresponds to variant dbSNP:rs9282817Ensembl.1
Natural variantiVAR_04942766S → F. Corresponds to variant dbSNP:rs9282819Ensembl.1
Natural variantiVAR_009526147S → C2 PublicationsCorresponds to variant dbSNP:rs17174794EnsemblClinVar.1
Natural variantiVAR_019252152N → D1 PublicationCorresponds to variant dbSNP:rs17174801Ensembl.1
Natural variantiVAR_009527260R → H1 PublicationCorresponds to variant dbSNP:rs1799974Ensembl.1
Natural variantiVAR_019253265R → C1 PublicationCorresponds to variant dbSNP:rs17174822Ensembl.1
Natural variantiVAR_019254274D → N1 PublicationCorresponds to variant dbSNP:rs17174829Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0423271 – 100Missing in isoform 12, isoform 14 and isoform 15. 4 PublicationsAdd BLAST100
Alternative sequenceiVSP_0423281 – 96MDSSA…MYVIV → MMRAKSISTKAGKPS in isoform 13. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0376931M → MCLHRRVPSEETYSLDRFAQ NPPLFPPPSLPASESRMAHA PLLQRCGAARTGFCKKQQEL WQRRKEAAEALGTRKVSVLL ATSHSGARPAVSTM in isoform 10. 2 Publications1
Alternative sequenceiVSP_04232997 – 400RYTKM…TAPLP → SSSWF in isoform 17. CuratedAdd BLAST304
Alternative sequenceiVSP_04233098 – 400YTKMK…TAPLP → YSWFVIGGPEGRRKQRRLGE DKRARGCGEKG in isoform 16. CuratedAdd BLAST303
Alternative sequenceiVSP_04757798 – 186YTKMK…TPRNA → FHRLYTNILSSNLVLGKPAE DLCFHLRLHYASAHHYRVLW TDDLAPQECPHALWLQRKGQ ESSKDHQDGAGGGGCVHRLL DSHSHLRHH in isoform 18. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_047578187 – 400Missing in isoform 18. 1 PublicationAdd BLAST214
Alternative sequenceiVSP_037694389 – 400LENLE…TAPLP → S in isoform 11. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_042331389 – 400LENLE…TAPLP → NYYIIHRCCCNTPLISQKPV LLWFCD in isoform 14. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_001896389 – 400LENLE…TAPLP → VRSL in isoform 2 and isoform 15. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_037695389 – 400LENLE…TAPLP → CLPIPSLSCWALEQGCLVVY PGPLQGPLVRYDLPAILHSS CLRGNTAPSPSGGAFLLS in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037696389 – 400LENLE…TAPLP → GPPAKFVADQLAGSS in isoform 4. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037697389 – 400LENLE…TAPLP → PPLAVSMAQIFTRYPPPTHR EKTCNDYMKR in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037698389 – 400LENLE…TAPLP → IRDPISNLPRVSVF in isoform 6. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_037699389 – 400LENLE…TAPLP → KIDLFQKSSLLNCEHTKG in isoform 7. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037700389 – 400LENLE…TAPLP → RERRQKSDW in isoform 8. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_037701389 – 400LENLE…TAPLP → VELNLDCHCENAKPWPLSYN AGQSPFPFPGRV in isoform 9. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L25119 mRNA Translation: AAA20580.1
U12569 mRNA Translation: AAB60354.1
L29301 mRNA Translation: AAA73958.1
AY036622 mRNA Translation: AAK74189.1
AY036623 mRNA Translation: AAK74190.1
AY195733 mRNA Translation: AAO21305.1
AY225404 mRNA Translation: AAP44727.1
AY309001 mRNA Translation: AAQ77385.1
AY309005 mRNA Translation: AAQ77389.1
AY309006 mRNA Translation: AAQ77390.1
AY309007 mRNA Translation: AAQ77391.1
AY309008 mRNA Translation: AAQ77392.1
AY309009 mRNA Translation: AAQ77393.1
EU340241 mRNA Translation: ACA49726.1
EU340242 mRNA Translation: ACA49727.1
EU340243 mRNA Translation: ACA49728.1
AY364230 mRNA Translation: AAR12887.1
AY364890 mRNA Translation: AAR11568.1
HQ699462 mRNA Translation: AET97615.1
EU360599 mRNA Translation: ABY61366.1
EU362990 mRNA Translation: ABY66530.1
AK313901 mRNA Translation: BAG36624.1
AY521028 mRNA Translation: AAS00462.1
AY587764 Genomic DNA Translation: AAS83107.1
FJ041292 mRNA Translation: ACM90350.1
FJ041293 mRNA Translation: ACM90351.1
FJ041294 mRNA Translation: ACM90352.1
AL132774 Genomic DNA No translation available.
AL136444 Genomic DNA No translation available.
AL445220 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47705.1 Different initiation.
BC074927 mRNA Translation: AAH74927.1
AY292290 Genomic DNA Translation: AAP44409.1
AY292291 Genomic DNA Translation: AAP44410.1
AF153500 Genomic DNA Translation: AAD44318.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS43517.1 [P35372-5]
CCDS43518.1 [P35372-3]
CCDS47503.1 [P35372-10]
CCDS47504.1 [P35372-7]
CCDS47505.1 [P35372-8]
CCDS47506.1 [P35372-4]
CCDS47507.1 [P35372-9]
CCDS47508.1 [P35372-2]
CCDS55068.1 [P35372-13]
CCDS55069.1 [P35372-11]
CCDS55070.1 [P35372-1]
CCDS55071.1 [P35372-12]

Protein sequence database of the Protein Information Resource

More...PIRi		I56553
S65693

NCBI Reference Sequences

More...RefSeqi		NP_000905.3, NM_000914.4 [P35372-1]
NP_001008503.2, NM_001008503.2 [P35372-5]
NP_001008504.2, NM_001008504.3 [P35372-2]
NP_001008505.2, NM_001008505.2 [P35372-3]
NP_001138751.1, NM_001145279.3 [P35372-10]
NP_001138752.1, NM_001145280.3 [P35372-12]
NP_001138753.1, NM_001145281.2 [P35372-13]
NP_001138754.1, NM_001145282.2 [P35372-7]
NP_001138755.1, NM_001145283.2 [P35372-8]
NP_001138756.1, NM_001145284.3 [P35372-4]
NP_001138757.1, NM_001145285.2 [P35372-11]
NP_001138758.1, NM_001145286.2 [P35372-9]
NP_001138759.1, NM_001145287.2 [P35372-12]
NP_001272452.1, NM_001285523.2
NP_001272453.1, NM_001285524.1 [P35372-10]
NP_001272455.1, NM_001285526.1 [P35372-12]
NP_001272456.1, NM_001285527.1 [P35372-15]
NP_001272457.1, NM_001285528.2 [P35372-14]
XP_016866395.1, XM_017010906.1 [P35372-12]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000229768; ENSP00000229768; ENSG00000112038 [P35372-3]
ENST00000330432; ENSP00000328264; ENSG00000112038 [P35372-1]
ENST00000337049; ENSP00000338381; ENSG00000112038 [P35372-5]
ENST00000414028; ENSP00000399359; ENSG00000112038 [P35372-4]
ENST00000419506; ENSP00000403549; ENSG00000112038 [P35372-9]
ENST00000428397; ENSP00000411903; ENSG00000112038 [P35372-2]
ENST00000434900; ENSP00000394624; ENSG00000112038 [P35372-10]
ENST00000435918; ENSP00000413752; ENSG00000112038 [P35372-8]
ENST00000452687; ENSP00000410497; ENSG00000112038 [P35372-7]
ENST00000518759; ENSP00000430260; ENSG00000112038 [P35372-13]
ENST00000519083; ENSP00000431048; ENSG00000112038 [P35372-6]
ENST00000520708; ENSP00000430876; ENSG00000112038 [P35372-12]
ENST00000522236; ENSP00000429373; ENSG00000112038 [P35372-12]
ENST00000522555; ENSP00000429719; ENSG00000112038 [P35372-12]
ENST00000522739; ENSP00000428018; ENSG00000112038 [P35372-6]
ENST00000524150; ENSP00000430575; ENSG00000112038 [P35372-18]
ENST00000524163; ENSP00000430097; ENSG00000112038 [P35372-11]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		4988

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:4988

UCSC genome browser

More...UCSCi		uc003qpn.4 human [P35372-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Mu opioid receptor entry

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L25119 mRNA Translation: AAA20580.1
U12569 mRNA Translation: AAB60354.1
L29301 mRNA Translation: AAA73958.1
AY036622 mRNA Translation: AAK74189.1
AY036623 mRNA Translation: AAK74190.1
AY195733 mRNA Translation: AAO21305.1
AY225404 mRNA Translation: AAP44727.1
AY309001 mRNA Translation: AAQ77385.1
AY309005 mRNA Translation: AAQ77389.1
AY309006 mRNA Translation: AAQ77390.1
AY309007 mRNA Translation: AAQ77391.1
AY309008 mRNA Translation: AAQ77392.1
AY309009 mRNA Translation: AAQ77393.1
EU340241 mRNA Translation: ACA49726.1
EU340242 mRNA Translation: ACA49727.1
EU340243 mRNA Translation: ACA49728.1
AY364230 mRNA Translation: AAR12887.1
AY364890 mRNA Translation: AAR11568.1
HQ699462 mRNA Translation: AET97615.1
EU360599 mRNA Translation: ABY61366.1
EU362990 mRNA Translation: ABY66530.1
AK313901 mRNA Translation: BAG36624.1
AY521028 mRNA Translation: AAS00462.1
AY587764 Genomic DNA Translation: AAS83107.1
FJ041292 mRNA Translation: ACM90350.1
FJ041293 mRNA Translation: ACM90351.1
FJ041294 mRNA Translation: ACM90352.1
AL132774 Genomic DNA No translation available.
AL136444 Genomic DNA No translation available.
AL445220 Genomic DNA No translation available.
CH471051 Genomic DNA Translation: EAW47705.1 Different initiation.
BC074927 mRNA Translation: AAH74927.1
AY292290 Genomic DNA Translation: AAP44409.1
AY292291 Genomic DNA Translation: AAP44410.1
AF153500 Genomic DNA Translation: AAD44318.1
CCDSiCCDS43517.1 [P35372-5]
CCDS43518.1 [P35372-3]
CCDS47503.1 [P35372-10]
CCDS47504.1 [P35372-7]
CCDS47505.1 [P35372-8]
CCDS47506.1 [P35372-4]
CCDS47507.1 [P35372-9]
CCDS47508.1 [P35372-2]
CCDS55068.1 [P35372-13]
CCDS55069.1 [P35372-11]
CCDS55070.1 [P35372-1]
CCDS55071.1 [P35372-12]
PIRiI56553
S65693
RefSeqiNP_000905.3, NM_000914.4 [P35372-1]
NP_001008503.2, NM_001008503.2 [P35372-5]
NP_001008504.2, NM_001008504.3 [P35372-2]
NP_001008505.2, NM_001008505.2 [P35372-3]
NP_001138751.1, NM_001145279.3 [P35372-10]
NP_001138752.1, NM_001145280.3 [P35372-12]
NP_001138753.1, NM_001145281.2 [P35372-13]
NP_001138754.1, NM_001145282.2 [P35372-7]
NP_001138755.1, NM_001145283.2 [P35372-8]
NP_001138756.1, NM_001145284.3 [P35372-4]
NP_001138757.1, NM_001145285.2 [P35372-11]
NP_001138758.1, NM_001145286.2 [P35372-9]
NP_001138759.1, NM_001145287.2 [P35372-12]
NP_001272452.1, NM_001285523.2
NP_001272453.1, NM_001285524.1 [P35372-10]
NP_001272455.1, NM_001285526.1 [P35372-12]
NP_001272456.1, NM_001285527.1 [P35372-15]
NP_001272457.1, NM_001285528.2 [P35372-14]
XP_016866395.1, XM_017010906.1 [P35372-12]

3D structure databases

SMRiP35372
ModBaseiSearch...

Protein-protein interaction databases

BioGridi111033, 79 interactors
IntActiP35372, 125 interactors
MINTiP35372
STRINGi9606.ENSP00000394624

Chemistry databases

BindingDBiP35372
ChEMBLiCHEMBL233
DrugBankiDB01571 3-Methylfentanyl
DB01439 3-Methylthiofentanyl
DB00802 Alfentanil
DB06274 Alvimopan
DB00321 Amitriptyline
DB00913 Anileridine
DB00921 Buprenorphine
DB00611 Butorphanol
DB09061 Cannabidiol
DB01535 Carfentanil
DB00318 Codeine
DB00514 Dextromethorphan
DB00647 Dextropropoxyphene
DB01209 Dezocine
DB01452 Diamorphine
DB01565 Dihydromorphine
DB01444 Dimethylthiambutene
DB01081 Diphenoxylate
DB01548 Diprenorphine
DB09272 Eluxadoline
DB05492 Epicept NP-1
DB01466 Ethylmorphine
DB01497 Etorphine
DB00813 Fentanyl
DB00956 Hydrocodone
DB00327 Hydromorphone
DB01221 Ketamine
DB06738 Ketobemidone
DB01227 Levacetylmethadol
DB00504 Levallorphan
DB00854 Levorphanol
DB05509 LI-301
DB00836 Loperamide
DB14146 Loxicodegol
DB14009 Medical Cannabis
DB00454 Meperidine
DB00333 Methadone
DB01433 Methadyl acetate
DB06800 Methylnaltrexone
DB00295 Morphine
DB06409 Morphine glucuronide
DB14011 Nabiximols
DB00844 Nalbuphine
DB11691 Naldemedine
DB06230 Nalmefene
DB09049 Naloxegol
DB01183 Naloxone
DB00704 Naltrexone
DB00904 Ondansetron
DB11130 Opium
DB00497 Oxycodone
DB01192 Oxymorphone
DB00652 Pentazocine
DB11186 Pentoxyverine
DB09209 Pholcodine
DB00899 Remifentanil
DB00708 Sufentanil
DB06204 Tapentadol
DB09289 Tianeptine
DB00193 Tramadol
DB09089 Trimebutine
DB05046 V1003
DrugCentraliP35372
GuidetoPHARMACOLOGYi319

Protein family/group databases

TCDBi9.A.14.13.18 the g-protein-coupled receptor (gpcr) family

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

iPTMnetiP35372
PhosphoSitePlusiP35372
SwissPalmiP35372

Polymorphism and mutation databases

BioMutaiOPRM1
DMDMi2851402

Proteomic databases

PaxDbiP35372
PeptideAtlasiP35372
PRIDEiP35372
ProteomicsDBi18945
55038 [P35372-1]
55039 [P35372-10]
55040 [P35372-11]
55041 [P35372-12]
55042 [P35372-13]
55043 [P35372-14]
55044 [P35372-15]
55045 [P35372-16]
55046 [P35372-17]
55047 [P35372-2]
55048 [P35372-3]
55049 [P35372-4]
55050 [P35372-5]
55051 [P35372-6]
55052 [P35372-7]
55053 [P35372-8]
55054 [P35372-9]

Genome annotation databases

EnsembliENST00000229768; ENSP00000229768; ENSG00000112038 [P35372-3]
ENST00000330432; ENSP00000328264; ENSG00000112038 [P35372-1]
ENST00000337049; ENSP00000338381; ENSG00000112038 [P35372-5]
ENST00000414028; ENSP00000399359; ENSG00000112038 [P35372-4]
ENST00000419506; ENSP00000403549; ENSG00000112038 [P35372-9]
ENST00000428397; ENSP00000411903; ENSG00000112038 [P35372-2]
ENST00000434900; ENSP00000394624; ENSG00000112038 [P35372-10]
ENST00000435918; ENSP00000413752; ENSG00000112038 [P35372-8]
ENST00000452687; ENSP00000410497; ENSG00000112038 [P35372-7]
ENST00000518759; ENSP00000430260; ENSG00000112038 [P35372-13]
ENST00000519083; ENSP00000431048; ENSG00000112038 [P35372-6]
ENST00000520708; ENSP00000430876; ENSG00000112038 [P35372-12]
ENST00000522236; ENSP00000429373; ENSG00000112038 [P35372-12]
ENST00000522555; ENSP00000429719; ENSG00000112038 [P35372-12]
ENST00000522739; ENSP00000428018; ENSG00000112038 [P35372-6]
ENST00000524150; ENSP00000430575; ENSG00000112038 [P35372-18]
ENST00000524163; ENSP00000430097; ENSG00000112038 [P35372-11]
GeneIDi4988
KEGGihsa:4988
UCSCiuc003qpn.4 human [P35372-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		4988
DisGeNETi4988

GeneCards: human genes, protein and diseases

More...GeneCardsi		OPRM1
HGNCiHGNC:8156 OPRM1
HPAiHPA014509
HPA067435
MIMi600018 gene
neXtProtiNX_P35372
OpenTargetsiENSG00000112038
PharmGKBiPA31945

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00940000158236
HOGENOMiHOG000230486
InParanoidiP35372
KOiK04215
OMAiPAWYWEN
OrthoDBi1011272at2759
PhylomeDBiP35372
TreeFamiTF315737

Enzyme and pathway databases

ReactomeiR-HSA-111885 Opioid Signalling
R-HSA-202040 G-protein activation
R-HSA-375276 Peptide ligand-binding receptors
R-HSA-418594 G alpha (i) signalling events
R-HSA-6785807 Interleukin-4 and Interleukin-13 signaling
R-HSA-9022699 MECP2 regulates neuronal receptors and channels
SIGNORiP35372

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		OPRM1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		%CE%9C-opioid_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		4988
PharosiP35372

Protein Ontology

More...PROi		PR:P35372

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000112038 Expressed in 36 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiP35372 baseline and differential
GenevisibleiP35372 HS

Family and domain databases

InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR000105 Mu_opioid_rcpt
IPR001418 Opioid_rcpt
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR00537 MUOPIOIDR
PR00384 OPIOIDR
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOPRM_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35372
Secondary accession number(s): B0FXJ1
, B2R9S7, B8Q1L7, B8Q1L8, B8Q1L9, E7EWZ3, G8XRH6, G8XRH8, Q12930, Q4VWM1, Q4VWM2, Q4VWM3, Q4VWM4, Q4VWM6, Q4VWX6, Q5TDA1, Q6UPP1, Q6UQ80, Q7Z2D8, Q86V80, Q8IWW3, Q8IWW4, Q9UCZ4, Q9UN57
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: July 15, 1998
Last modified: November 13, 2019
This is version 195 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  4. SIMILARITY comments
    Index of protein domains and families
  5. UniProtKB entry view manual
    User manual for the UniProtKB entry view
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again