Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P35348 (ADA1A_HUMAN)

Entry version 203 (07 Oct 2020)
Sequence version 2 (01 Nov 1995)
Previous versions | rss
Add a publicationFeedback
Protein

Alpha-1A adrenergic receptor

Gene

ADRA1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P35348

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-390696, Adrenoceptors
R-HSA-416476, G alpha (q) signalling events
R-HSA-416482, G alpha (12/13) signalling events

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P35348

SIGNOR Signaling Network Open Resource

More...SIGNORi		P35348

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-1A adrenergic receptor
Alternative name(s):
Alpha-1A adrenoreceptor
Short name:
Alpha-1A adrenoceptor
Alpha-1C adrenergic receptor
Alpha-adrenergic receptor 1c
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADRA1A
Synonyms:ADRA1C
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000120907.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:277, ADRA1A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		104221, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P35348

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 27ExtracellularBy similarityAdd BLAST27
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei28 – 51Helical; Name=1By similarityAdd BLAST24
Topological domaini52 – 64CytoplasmicBy similarityAdd BLAST13
Transmembranei65 – 88Helical; Name=2By similarityAdd BLAST24
Topological domaini89 – 99ExtracellularBy similarityAdd BLAST11
Transmembranei100 – 122Helical; Name=3By similarityAdd BLAST23
Topological domaini123 – 143CytoplasmicBy similarityAdd BLAST21
Transmembranei144 – 167Helical; Name=4By similarityAdd BLAST24
Topological domaini168 – 181ExtracellularBy similarityAdd BLAST14
Transmembranei182 – 205Helical; Name=5By similarityAdd BLAST24
Topological domaini206 – 273CytoplasmicBy similarityAdd BLAST68
Transmembranei274 – 297Helical; Name=6By similarityAdd BLAST24
Topological domaini298 – 305ExtracellularBy similarity8
Transmembranei306 – 329Helical; Name=7By similarityAdd BLAST24
Topological domaini330 – 466CytoplasmicBy similarityAdd BLAST137

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi334K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-335; A-342; A-348 and A-349. 1 Publication1
Mutagenesisi335K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-342; A-348 and A-349. 1 Publication1
Mutagenesisi342R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-348 and A-349. 1 Publication1
Mutagenesisi348R → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-349. 1 Publication1
Mutagenesisi349K → A: Abolishes targeting to the nuclear membrane of cardiac myocytes; when associated with A-334; A-335; A-342 and A-348. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		148

Open Targets

More...OpenTargetsi		ENSG00000120907

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA34

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P35348, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL229

Drug and drug target database

More...DrugBanki		DB01472, 4-Methoxyamphetamine
DB01614, Acepromazine
DB00346, Alfuzosin
DB00321, Amitriptyline
DB00543, Amoxapine
DB00182, Amphetamine
DB00964, Apraclonidine
DB09229, Aranidipine
DB01238, Aripiprazole
DB14185, Aripiprazole lauroxil
DB09204, Arotinolol
DB06216, Asenapine
DB00865, Benzphetamine
DB01295, Bevantolol
DB01200, Bromocriptine
DB00490, Buspirone
DB00248, Cabergoline
DB01136, Carvedilol
DB00477, Chlorpromazine
DB09202, Cirazoline
DB00575, Clonidine
DB00363, Clozapine
DB00298, Dapiprazole
DB01151, Desipramine
DB01576, Dextroamphetamine
DB11273, Dihydroergocornine
DB13345, Dihydroergocristine
DB00449, Dipivefrin
DB11278, DL-Methylephedrine
DB00841, Dobutamine
DB09167, Dosulepin
DB00590, Doxazosin
DB01142, Doxepin
DB04855, Dronedarone
DB00450, Droperidol
DB06262, Droxidopa
DB01364, Ephedrine
DB05492, Epicept NP-1
DB00751, Epinastine
DB00668, Epinephrine
DB01049, Ergoloid mesylate
DB01253, Ergometrine
DB00696, Ergotamine
DB01175, Escitalopram
DB09194, Etoperidone
DB00800, Fenoldopam
DB00875, Flupentixol
DB00502, Haloperidol
DB04946, Iloperidone
DB00458, Imipramine
DB11577, Indigotindisulfonic acid
DB08950, Indoramin
DB06706, Isometheptene
DB00598, Labetalol
DB00555, Lamotrigine
DB04948, Lofexidine
DB09195, Lorpiprazole
DB00408, Loxapine
DB00934, Maprotiline
DB01365, Mephentermine
DB00610, Metaraminol
DB01403, Methotrimeprazine
DB00723, Methoxamine
DB06148, Mianserin
DB00211, Midodrine
DB00370, Mirtazapine
DB09205, Moxisylyte
DB06711, Naphazoline
DB01149, Nefazodone
DB00622, Nicardipine
DB00699, Nicergoline
DB09239, Niguldipine
DB00368, Norepinephrine
DB00540, Nortriptyline
DB06229, Ocaperidone
DB00334, Olanzapine
DB00935, Oxymetazoline
DB01267, Paliperidone
DB00715, Paroxetine
DB01186, Pergolide
DB08922, Perospirone
DB01579, Phendimetrazine
DB00925, Phenoxybenzamine
DB00692, Phentolamine
DB00388, Phenylephrine
DB09286, Pipamperone
DB06153, Pizotifen
DB00457, Prazosin
DB00433, Prochlorperazine
DB00420, Promazine
DB01069, Promethazine
DB00777, Propiomazine
DB12278, Propiverine
DB00852, Pseudoephedrine
DB01224, Quetiapine
DB00908, Quinidine
DB05469, R450
DB11124, Racepinephrine
DB00243, Ranolazine
DB00734, Risperidone
DB00268, Ropinirole
DB06144, Sertindole
DB06207, Silodosin
DB09203, Synephrine
DB00706, Tamsulosin
DB01162, Terazosin
DB06764, Tetryzoline
DB01622, Thioproperazine
DB00679, Thioridazine
DB13025, Tiapride
DB00697, Tizanidine
DB00797, Tolazoline
DB00656, Trazodone
DB00831, Trifluoperazine
DB00726, Trimipramine
DB00661, Verapamil
DB06694, Xylometazoline
DB00246, Ziprasidone
DB01624, Zuclopenthixol

DrugCentral

More...DrugCentrali		P35348

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		22

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADRA1A

Domain mapping of disease mutations (DMDM)

More...DMDMi		1168246

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000690631 – 466Alpha-1A adrenergic receptorAdd BLAST466

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi7N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi13N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi22N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi99 ↔ 176PROSITE-ProRule annotation
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei215Phosphoserine; by PKASequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi345S-palmitoyl cysteineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

C-terminal Ser or Thr residues may be phosphorylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P35348

PeptideAtlas

More...PeptideAtlasi		P35348

PRoteomics IDEntifications database

More...PRIDEi		P35348

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		55026 [P35348-1]
55027 [P35348-2]
55028 [P35348-3]
55029 [P35348-4]
55030 [P35348-5]
55031 [P35348-6]
55032 [P35348-7]
55033 [P35348-8]
55034 [P35348-9]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P35348, 3 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P35348

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P35348

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000120907, Expressed in liver and 133 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P35348, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P35348, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000120907, Tissue enhanced (liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homo- and heterooligomer. Heterooligomerizes with ADRA1B homooligomers in cardiac myocytes (PubMed:22120526).

Interacts with CAVIN4 (PubMed:24567387).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		106658, 3 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P35348

Database of interacting proteins

More...DIPi		DIP-33401N

Protein interaction database and analysis system

More...IntActi		P35348, 33 interactors

Molecular INTeraction database

More...MINTi		P35348

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000369960

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P35348

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P35348, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi334 – 349Nuclear localization signalAdd BLAST16

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1A sub-subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3656, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159105

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_009579_11_6_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P35348

KEGG Orthology (KO)

More...KOi		K04135

Identification of Orthologs from Complete Genome Data

More...OMAi		HLQSVTH

Database of Orthologous Groups

More...OrthoDBi		1095345at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P35348

TreeFam database of animal gene trees

More...TreeFami		TF331895

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002233, ADR_fam
IPR001004, ADRA1A_rcpt
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001, 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01103, ADRENERGICR
PR00557, ADRENRGCA1AR
PR00237, GPCRRHODOPSN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01381, 7TM_GPCR_Srsx, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P35348-1) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-1, Alpha(1A-1)

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVFLSGNASD SSNCTQPPAP VNISKAILLG VILGGLILFG VLGNILVILS 
        60         70         80         90        100
VACHRHLHSV THYYIVNLAV ADLLLTSTVL PFSAIFEVLG YWAFGRVFCN 
       110        120        130        140        150
IWAAVDVLCC TASIMGLCII SIDRYIGVSY PLRYPTIVTQ RRGLMALLCV 
       160        170        180        190        200
WALSLVISIG PLFGWRQPAP EDETICQINE EPGYVLFSAL GSFYLPLAII 
       210        220        230        240        250
LVMYCRVYVV AKRESRGLKS GLKTDKSDSE QVTLRIHRKN APAGGSGMAS 
       260        270        280        290        300
AKTKTHFSVR LLKFSREKKA AKTLGIVVGC FVLCWLPFFL VMPIGSFFPD 
       310        320        330        340        350
FKPSETVFKI VFWLGYLNSC INPIIYPCSS QEFKKAFQNV LRIQCLCRKQ 
       360        370        380        390        400
SSKHALGYTL HPPSQAVEGQ HKDMVRIPVG SRETFYRISK TDGVCEWKFF 
       410        420        430        440        450
SSMPRGSARI TVSKDQSSCT TARVRSKSFL QVCCCVGPST PSLDKNHQVP 
       460 
TIKVHTISLS ENGEEV
Length:466
Mass (Da):51,487
Last modified:November 1, 1995 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1A50487531DECDF0
GO
Isoform 2 (identifier: P35348-2) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-2, Alpha(1A-2)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVC...ISLSENGEEV → TKSRSVTRLE...CHQADATRPS

Show »
Length:475
Mass (Da):52,205
Checksum:iDE3CEEDD1AB3E56D
GO
Isoform 3 (identifier: P35348-3) [UniParc]FASTAAdd to basket
Also known as: Alpha 1c-3, Alpha(1A-3)

The sequence of this isoform differs from the canonical sequence as follows:
     424-429: VRSKSF → GHTPMT
     430-466: Missing.

Show »
Length:429
Mass (Da):47,461
Checksum:iE67B19B5CA668687
GO
Isoform 4 (identifier: P35348-4) [UniParc]FASTAAdd to basket
Also known as: Alpha(1A-4)

The sequence of this isoform differs from the canonical sequence as follows:
     424-466: VRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV → RGMDCRYFTKNCREHIKHVNFMMPPWRKGSEC

Show »
Length:455
Mass (Da):50,777
Checksum:i80C61B88FA608B6C
GO
Isoform 5 (identifier: P35348-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-297: SF → KS
     298-466: Missing.

Show »
Length:297
Mass (Da):32,433
Checksum:i4871F9BE42A87D6E
GO
Isoform 6 (identifier: P35348-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     295-342: GSFFPDFKPS...FKKAFQNVLR → DEETEAQEGK...VSRKDTCGVW
     343-466: Missing.

Show »
Length:342
Mass (Da):37,468
Checksum:i2B6E7CC81B9CBE50
GO
Isoform 7 (identifier: P35348-7) [UniParc]FASTAAdd to basket
Also known as: 2b/3b

The sequence of this isoform differs from the canonical sequence as follows:
     296-324: SFFPDFKPSETVFKIVFWLGYLNSCINPI → TYILKYDVLFWRKGLSVCTRLRERKEIKN
     325-466: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:324
Mass (Da):35,829
Checksum:i608DACD5497EE83E
GO
Isoform 8 (identifier: P35348-8) [UniParc]FASTAAdd to basket
Also known as: 2c

The sequence of this isoform differs from the canonical sequence as follows:
     295-466: GSFFPDFKPS...ISLSENGEEV → DEVSLCHQAG...GQDDLDLLTS

Show »
Length:370
Mass (Da):40,725
Checksum:iF00E717A4C4A59AC
GO
Isoform 9 (identifier: P35348-9) [UniParc]FASTAAdd to basket
Also known as: 3c

The sequence of this isoform differs from the canonical sequence as follows:
     296-466: SFFPDFKPSE...ISLSENGEEV → THTHDMKPAS...TVTDTGKTVT

Show »
Length:372
Mass (Da):40,638
Checksum:i839C5750F9B428F5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EW16E7EW16_HUMAN
Alpha-1A adrenergic receptor
ADRA1A
427Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ACA05900 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAA06901 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti43G → C in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti129S → T in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti130Y → H in AAK77197 (Ref. 9) Curated1
Sequence conflicti185V → A in AAH95512 (PubMed:15489334).Curated1
Sequence conflicti338Q → C (PubMed:8024574).Curated1
Sequence conflicti359T → P in AAA93114 (PubMed:8564208).Curated1
Sequence conflicti384T → A in AAK77197 (Ref. 9) Curated1
Sequence conflicti387R → G in AAK77197 (Ref. 9) Curated1
Sequence conflicti390K → R in AAK77197 (Ref. 9) Curated1
Sequence conflicti431Q → E in BAA04960 (PubMed:8396931).Curated1
Sequence conflicti437G → E in AAK77197 (Ref. 9) Curated1
Sequence conflicti442S → C in AAA93114 (PubMed:8564208).Curated1
Isoform 6 (identifier: P35348-6)
Sequence conflicti302E → Q in AAR84650 (PubMed:10493934).Curated1
Isoform 4 (identifier: P35348-4)
Sequence conflicti453S → L in AAC06138 (PubMed:9490024).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03575640G → W in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_049370200I → S. Corresponds to variant dbSNP:rs2229125Ensembl.1
Natural variantiVAR_019509347C → R Frequent polymorphism. 9 PublicationsCorresponds to variant dbSNP:rs1048101Ensembl.1
Natural variantiVAR_049371414K → R. Corresponds to variant dbSNP:rs3730247Ensembl.1
Natural variantiVAR_049372465E → D. Corresponds to variant dbSNP:rs2229126Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011046295 – 466GSFFP…NGEEV → DEVSLCHQAGVQWHDLGSLQ PPPPGFKRFSCLSLPSSWDY RDVPPGRRHQAQLIFVFLVE TGFHHVGQDDLDLLTS in isoform 8. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_011053295 – 342GSFFP…QNVLR → DEETEAQEGKNDSPSFKQPV HHAAVLGLEVMEKENLEGVS RKDTCGVW in isoform 6. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_011049296 – 466SFFPD…NGEEV → THTHDMKPASRPRLLSLLPK EGEHETHHWSCDPLSLESTP GAQEPCLTLGFTSLSSIHLT KAQIQHVTVTDTGKTVT in isoform 9. 1 PublicationAdd BLAST171
Alternative sequenceiVSP_011047296 – 324SFFPD…CINPI → TYILKYDVLFWRKGLSVCTR LRERKEIKN in isoform 7. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_011051296 – 297SF → KS in isoform 5. 1 Publication2
Alternative sequenceiVSP_011052298 – 466Missing in isoform 5. 1 PublicationAdd BLAST169
Alternative sequenceiVSP_011048325 – 466Missing in isoform 7. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_011054343 – 466Missing in isoform 6. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_011055424 – 466VRSKS…NGEEV → TKSRSVTRLECSGMILAHCN LRLPGSRDSPASASQAAGTT GMCHQADATRPS in isoform 2. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_011050424 – 466VRSKS…NGEEV → RGMDCRYFTKNCREHIKHVN FMMPPWRKGSEC in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_011044424 – 429VRSKSF → GHTPMT in isoform 3. 1 Publication6
Alternative sequenceiVSP_011045430 – 466Missing in isoform 3. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D25235 mRNA Translation: BAA04960.1
U03866 Genomic DNA Translation: AAB60353.1
U02569 mRNA Translation: AAA93114.1
D32201 mRNA Translation: BAA06900.1
D32202 mRNA Translation: BAA06901.1 Frameshift.
L31774 mRNA Translation: AAB59486.1
AF013261 mRNA Translation: AAC06138.1
AY491775 mRNA Translation: AAR84644.1
AY491776 mRNA Translation: AAR84645.1
AY491777 mRNA Translation: AAR84646.1
AY491778 mRNA Translation: AAR84647.1
AY491779 mRNA Translation: AAR84648.1
AY491780 mRNA Translation: AAR84649.1
AY491781 mRNA Translation: AAR84650.1
AF395806 mRNA Translation: AAK77197.1
AB065703 Genomic DNA Translation: BAC05926.1
AY389505 Genomic DNA Translation: AAQ91331.1
AK289548 mRNA Translation: BAF82237.1
EU326301 Genomic DNA Translation: ACA05899.1
EU326301 Genomic DNA Translation: ACA05900.1 Sequence problems.
EU326301 Genomic DNA Translation: ACA05902.1
EU326301 Genomic DNA Translation: ACA05903.1
EU326301 Genomic DNA Translation: ACA05904.1
EU326301 Genomic DNA Translation: ACA05905.1
EU326301 Genomic DNA Translation: ACA05906.1
EU326301 Genomic DNA Translation: ACA05907.1
BC095512 mRNA Translation: AAH95512.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34869.1 [P35348-2]
CCDS6052.1 [P35348-3]
CCDS6053.1 [P35348-4]
CCDS6054.1 [P35348-1]
CCDS83269.1 [P35348-6]

Protein sequence database of the Protein Information Resource

More...PIRi		JN0765
S65656
S65657

NCBI Reference Sequences

More...RefSeqi		NP_000671.2, NM_000680.3 [P35348-1]
NP_001309431.1, NM_001322502.1 [P35348-9]
NP_001309432.1, NM_001322503.1 [P35348-8]
NP_001309433.1, NM_001322504.1 [P35348-6]
NP_150645.2, NM_033302.3 [P35348-3]
NP_150646.3, NM_033303.4 [P35348-2]
NP_150647.2, NM_033304.3 [P35348-4]
XP_006716356.1, XM_006716293.3 [P35348-3]
XP_011542713.1, XM_011544411.2 [P35348-7]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000276393; ENSP00000276393; ENSG00000120907 [P35348-1]
ENST00000354550; ENSP00000346557; ENSG00000120907 [P35348-4]
ENST00000380572; ENSP00000369946; ENSG00000120907 [P35348-6]
ENST00000380573; ENSP00000369947; ENSG00000120907 [P35348-1]
ENST00000380582; ENSP00000369956; ENSG00000120907 [P35348-3]
ENST00000380586; ENSP00000369960; ENSG00000120907 [P35348-2]
ENST00000519096; ENSP00000431073; ENSG00000120907 [P35348-7]
ENST00000521711; ENSP00000430414; ENSG00000120907 [P35348-7]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		148

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:148

UCSC genome browser

More...UCSCi		uc003xfc.1, human [P35348-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D25235 mRNA Translation: BAA04960.1
U03866 Genomic DNA Translation: AAB60353.1
U02569 mRNA Translation: AAA93114.1
D32201 mRNA Translation: BAA06900.1
D32202 mRNA Translation: BAA06901.1 Frameshift.
L31774 mRNA Translation: AAB59486.1
AF013261 mRNA Translation: AAC06138.1
AY491775 mRNA Translation: AAR84644.1
AY491776 mRNA Translation: AAR84645.1
AY491777 mRNA Translation: AAR84646.1
AY491778 mRNA Translation: AAR84647.1
AY491779 mRNA Translation: AAR84648.1
AY491780 mRNA Translation: AAR84649.1
AY491781 mRNA Translation: AAR84650.1
AF395806 mRNA Translation: AAK77197.1
AB065703 Genomic DNA Translation: BAC05926.1
AY389505 Genomic DNA Translation: AAQ91331.1
AK289548 mRNA Translation: BAF82237.1
EU326301 Genomic DNA Translation: ACA05899.1
EU326301 Genomic DNA Translation: ACA05900.1 Sequence problems.
EU326301 Genomic DNA Translation: ACA05902.1
EU326301 Genomic DNA Translation: ACA05903.1
EU326301 Genomic DNA Translation: ACA05904.1
EU326301 Genomic DNA Translation: ACA05905.1
EU326301 Genomic DNA Translation: ACA05906.1
EU326301 Genomic DNA Translation: ACA05907.1
BC095512 mRNA Translation: AAH95512.1
CCDSiCCDS34869.1 [P35348-2]
CCDS6052.1 [P35348-3]
CCDS6053.1 [P35348-4]
CCDS6054.1 [P35348-1]
CCDS83269.1 [P35348-6]
PIRiJN0765
S65656
S65657
RefSeqiNP_000671.2, NM_000680.3 [P35348-1]
NP_001309431.1, NM_001322502.1 [P35348-9]
NP_001309432.1, NM_001322503.1 [P35348-8]
NP_001309433.1, NM_001322504.1 [P35348-6]
NP_150645.2, NM_033302.3 [P35348-3]
NP_150646.3, NM_033303.4 [P35348-2]
NP_150647.2, NM_033304.3 [P35348-4]
XP_006716356.1, XM_006716293.3 [P35348-3]
XP_011542713.1, XM_011544411.2 [P35348-7]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi106658, 3 interactors
CORUMiP35348
DIPiDIP-33401N
IntActiP35348, 33 interactors
MINTiP35348
STRINGi9606.ENSP00000369960

Chemistry databases

BindingDBiP35348
ChEMBLiCHEMBL229
DrugBankiDB01472, 4-Methoxyamphetamine
DB01614, Acepromazine
DB00346, Alfuzosin
DB00321, Amitriptyline
DB00543, Amoxapine
DB00182, Amphetamine
DB00964, Apraclonidine
DB09229, Aranidipine
DB01238, Aripiprazole
DB14185, Aripiprazole lauroxil
DB09204, Arotinolol
DB06216, Asenapine
DB00865, Benzphetamine
DB01295, Bevantolol
DB01200, Bromocriptine
DB00490, Buspirone
DB00248, Cabergoline
DB01136, Carvedilol
DB00477, Chlorpromazine
DB09202, Cirazoline
DB00575, Clonidine
DB00363, Clozapine
DB00298, Dapiprazole
DB01151, Desipramine
DB01576, Dextroamphetamine
DB11273, Dihydroergocornine
DB13345, Dihydroergocristine
DB00449, Dipivefrin
DB11278, DL-Methylephedrine
DB00841, Dobutamine
DB09167, Dosulepin
DB00590, Doxazosin
DB01142, Doxepin
DB04855, Dronedarone
DB00450, Droperidol
DB06262, Droxidopa
DB01364, Ephedrine
DB05492, Epicept NP-1
DB00751, Epinastine
DB00668, Epinephrine
DB01049, Ergoloid mesylate
DB01253, Ergometrine
DB00696, Ergotamine
DB01175, Escitalopram
DB09194, Etoperidone
DB00800, Fenoldopam
DB00875, Flupentixol
DB00502, Haloperidol
DB04946, Iloperidone
DB00458, Imipramine
DB11577, Indigotindisulfonic acid
DB08950, Indoramin
DB06706, Isometheptene
DB00598, Labetalol
DB00555, Lamotrigine
DB04948, Lofexidine
DB09195, Lorpiprazole
DB00408, Loxapine
DB00934, Maprotiline
DB01365, Mephentermine
DB00610, Metaraminol
DB01403, Methotrimeprazine
DB00723, Methoxamine
DB06148, Mianserin
DB00211, Midodrine
DB00370, Mirtazapine
DB09205, Moxisylyte
DB06711, Naphazoline
DB01149, Nefazodone
DB00622, Nicardipine
DB00699, Nicergoline
DB09239, Niguldipine
DB00368, Norepinephrine
DB00540, Nortriptyline
DB06229, Ocaperidone
DB00334, Olanzapine
DB00935, Oxymetazoline
DB01267, Paliperidone
DB00715, Paroxetine
DB01186, Pergolide
DB08922, Perospirone
DB01579, Phendimetrazine
DB00925, Phenoxybenzamine
DB00692, Phentolamine
DB00388, Phenylephrine
DB09286, Pipamperone
DB06153, Pizotifen
DB00457, Prazosin
DB00433, Prochlorperazine
DB00420, Promazine
DB01069, Promethazine
DB00777, Propiomazine
DB12278, Propiverine
DB00852, Pseudoephedrine
DB01224, Quetiapine
DB00908, Quinidine
DB05469, R450
DB11124, Racepinephrine
DB00243, Ranolazine
DB00734, Risperidone
DB00268, Ropinirole
DB06144, Sertindole
DB06207, Silodosin
DB09203, Synephrine
DB00706, Tamsulosin
DB01162, Terazosin
DB06764, Tetryzoline
DB01622, Thioproperazine
DB00679, Thioridazine
DB13025, Tiapride
DB00697, Tizanidine
DB00797, Tolazoline
DB00656, Trazodone
DB00831, Trifluoperazine
DB00726, Trimipramine
DB00661, Verapamil
DB06694, Xylometazoline
DB00246, Ziprasidone
DB01624, Zuclopenthixol
DrugCentraliP35348
GuidetoPHARMACOLOGYi22

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

GlyGeniP35348, 3 sites
iPTMnetiP35348
PhosphoSitePlusiP35348

Polymorphism and mutation databases

BioMutaiADRA1A
DMDMi1168246

Proteomic databases

PaxDbiP35348
PeptideAtlasiP35348
PRIDEiP35348
ProteomicsDBi55026 [P35348-1]
55027 [P35348-2]
55028 [P35348-3]
55029 [P35348-4]
55030 [P35348-5]
55031 [P35348-6]
55032 [P35348-7]
55033 [P35348-8]
55034 [P35348-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		10062, 348 antibodies

Genome annotation databases

EnsembliENST00000276393; ENSP00000276393; ENSG00000120907 [P35348-1]
ENST00000354550; ENSP00000346557; ENSG00000120907 [P35348-4]
ENST00000380572; ENSP00000369946; ENSG00000120907 [P35348-6]
ENST00000380573; ENSP00000369947; ENSG00000120907 [P35348-1]
ENST00000380582; ENSP00000369956; ENSG00000120907 [P35348-3]
ENST00000380586; ENSP00000369960; ENSG00000120907 [P35348-2]
ENST00000519096; ENSP00000431073; ENSG00000120907 [P35348-7]
ENST00000521711; ENSP00000430414; ENSG00000120907 [P35348-7]
GeneIDi148
KEGGihsa:148
UCSCiuc003xfc.1, human [P35348-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		148
DisGeNETi148
EuPathDBiHostDB:ENSG00000120907.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADRA1A
HGNCiHGNC:277, ADRA1A
HPAiENSG00000120907, Tissue enhanced (liver)
MIMi104221, gene
neXtProtiNX_P35348
OpenTargetsiENSG00000120907
PharmGKBiPA34

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3656, Eukaryota
GeneTreeiENSGT00940000159105
HOGENOMiCLU_009579_11_6_1
InParanoidiP35348
KOiK04135
OMAiHLQSVTH
OrthoDBi1095345at2759
PhylomeDBiP35348
TreeFamiTF331895

Enzyme and pathway databases

PathwayCommonsiP35348
ReactomeiR-HSA-390696, Adrenoceptors
R-HSA-416476, G alpha (q) signalling events
R-HSA-416482, G alpha (12/13) signalling events
SignaLinkiP35348
SIGNORiP35348

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		148, 2 hits in 874 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Alpha-1A_adrenergic_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		148
PharosiP35348, Tclin

Protein Ontology

More...PROi		PR:P35348
RNActiP35348, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000120907, Expressed in liver and 133 other tissues
ExpressionAtlasiP35348, baseline and differential
GenevisibleiP35348, HS

Family and domain databases

InterProiView protein in InterPro
IPR002233, ADR_fam
IPR001004, ADRA1A_rcpt
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001, 7tm_1, 1 hit
PRINTSiPR01103, ADRENERGICR
PR00557, ADRENRGCA1AR
PR00237, GPCRRHODOPSN
SMARTiView protein in SMART
SM01381, 7TM_GPCR_Srsx, 1 hit
PROSITEiView protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADA1A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35348
Secondary accession number(s): A8K0I3
, B0ZBD1, B0ZBD2, B0ZBD4, B0ZBD5, B0ZBD6, B0ZBD8, B0ZBD9, O60451, Q13675, Q13729, Q4VBM7, Q6RUJ4, Q6RUJ5, Q6RUJ7, Q6RUJ8, Q6RUJ9, Q96RE8, Q9UD63, Q9UD67
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: November 1, 1995
Last modified: October 7, 2020
This is version 203 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again