UniProtKB - P35285 (RB22A_MOUSE)

BLAST

>sp|P35285|RB22A_MOUSE Ras-related protein Rab-22A OS=Mus musculus OX=10090 GN=Rab22a PE=1 SV=2
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWD
TAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKC
DLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANPASGGKGF
KLRRQPSEPKRSCC

Align
Format
Add to basket Added to basket
History
Entry version 161 (07 Nov 2018)
Sequence version 2 (26 Apr 2004)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Ras-related protein Rab-22A

Gene

Rab22a

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Plays a role in endocytosis and intracellular protein transport (PubMed:19759177, PubMed:27718357). Mediates trafficking of TF from early endosomes to recycling endosomes. Required for NGF-mediated endocytosis of NTRK1, and subsequent neurite outgrowth. Binds GTP and GDP and has low GTPase activity. Alternates between a GTP-bound active form and a GDP-bound inactive form (By similarity).By similarity2 Publications

Regions

Feature key	Position(s)	DescriptionActions	Length
Nucleotide bindingⁱ	12 – 20	GTP	9
Nucleotide bindingⁱ	60 – 64	GTP	5
Nucleotide bindingⁱ	118 – 121	GTP	4
Nucleotide bindingⁱ	148 – 150	GTP	3

GO - Molecular functionⁱ

GDP binding Source: UniProtKB
GTPase activity
Source: UniProtKB
Inferred from direct assayⁱ
- 16034420
GTP binding
Source: UniProtKB
Inferred from direct assayⁱ
- 16034420

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

endocytosis Source: MGI
endosome organization Source: Ensembl
intracellular protein transport
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
Rab protein signal transduction
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
regulation of vesicle size Source: MGI

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Endocytosis, Protein transport, Transport
Ligand	GTP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactomeⁱ	R-MMU-8873719 RAB geranylgeranylation

Reactomeⁱ

R-MMU-8873719 RAB geranylgeranylation

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Ras-related protein Rab-22A Short name: Rab-22 Alternative name(s): Rab-14
Gene namesⁱ	Name:Rab22a Synonyms:Rab22
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 2

Organism-specific databases

MGIⁱ	MGI:105072 Rab22a

Keywords - Cellular componentⁱ

Cell membrane, Cell projection, Cytoplasmic vesicle, Endosome, Membrane

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	64	Q → L: Constitutively active. Disrupts general recycling of receptors in embryonic fibroblasts. 1 Publication		1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000121210	1 – 194	Ras-related protein Rab-22AAdd BLAST		194

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Lipidationⁱ	193	S-geranylgeranyl cysteineBy similarity		1
Lipidationⁱ	194	S-geranylgeranyl cysteineBy similarity		1

Keywords - PTMⁱ

Lipoprotein, Prenylation

Proteomic databases

EPDⁱ	P35285
PaxDbⁱ	P35285
PeptideAtlas More...PeptideAtlasⁱ	P35285
PRIDEⁱ	P35285

PTM databases

iPTMnetⁱ	P35285
PhosphoSitePlusⁱ	P35285

Expressionⁱ

Tissue specificityⁱ

Detected in brain and heart, and at lower levels in lung and spleen.1 Publication

Gene expression databases

Bgeeⁱ	ENSMUSG00000027519 Expressed in 277 organ(s), highest expression level in humerus cartilage element
CleanExⁱ	MM_RAB22A
ExpressionAtlasⁱ	P35285 baseline and differential
Genevisibleⁱ	P35285 MM

Interactionⁱ

Subunit structureⁱ

Binds EEA1 (By similarity). Interacts (in its GTP-bound form) with RINL (By similarity). Interacts directly with ZFYVE20 (PubMed:16034420). Interacts (in its GTP-bound form) with RABGEF1 (PubMed:19759177).By similarity2 Publications

Protein-protein interaction databases

BioGridⁱ	202539, 1 interactor
Database of interacting proteins More...DIPⁱ	DIP-60516N
IntActⁱ	P35285, 35 interactors
Molecular INTeraction database More...MINTⁱ	P35285
STRINGⁱ	10090.ENSMUSP00000029024

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	2 – 11	Combined sources	10
Helixⁱ	18 – 27	Combined sources	10
Beta strandⁱ	39 – 49	Combined sources	11
Beta strandⁱ	52 – 61	Combined sources	10
Helixⁱ	65 – 71	Combined sources	7
Helixⁱ	72 – 75	Combined sources	4
Beta strandⁱ	79 – 86	Combined sources	8
Helixⁱ	90 – 106	Combined sources	17
Beta strandⁱ	111 – 118	Combined sources	8
Helixⁱ	123 – 125	Combined sources	3
Helixⁱ	130 – 139	Combined sources	10
Beta strandⁱ	143 – 146	Combined sources	4
Turnⁱ	149 – 152	Combined sources	4
Helixⁱ	155 – 165	Combined sources	11

Show more details

3D structure databases

ProteinModelPortalⁱ	P35285
SMRⁱ	P35285
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P35285

Family & Domainsⁱ

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	34 – 42	Effector regionBy similarity		9

Sequence similaritiesⁱ

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGⁱ	KOG0092 Eukaryota ENOG410YCCP LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000119101
HOGENOMⁱ	HOG000233968
HOVERGENⁱ	HBG009351
InParanoidⁱ	P35285
KEGG Orthology (KO) More...KOⁱ	K07891
OMAⁱ	KCDLSDA
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0HKN
PhylomeDBⁱ	P35285
TreeFamⁱ	TF331262

Family and domain databases

InterProⁱ	View protein in InterPro IPR027417 P-loop_NTPase IPR005225 Small_GTP-bd_dom IPR001806 Small_GTPase
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00071 Ras, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR00231 small_GTP, 1 hit
PROSITEⁱ	View protein in PROSITE PS51419 RAB, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

P35285-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MALRELKVCL LGDTGVGKSS IVWRFVEDSF DPNINPTIGA SFMTKTVQYQ 
        60         70         80         90        100
NELHKFLIWD TAGQERFRAL APMYYRGSAA AIIVYDITKE ETFSTLKNWV 
       110        120        130        140        150
RELRQHGPPS IVVAIAGNKC DLTDVREVME RDAKDYADSI HAIFVETSAK 
       160        170        180        190 
NAININELFI EISRRIPSTD ANPASGGKGF KLRRQPSEPK RSCC

Length:194

Mass (Da):21,802

Last modified:April 26, 2004 - v2

Checksum:ⁱ1799B676CA9091F7

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

D6RFT6	D6RFT6_MOUSE	Ras-related protein Rab-22A Ras-related protein Rab-22A	Rab22a	68	Annotation score:
A2ARZ7	A2ARZ7_MOUSE	RAB22A, member RAS oncogene family,... RAB22A, member RAS oncogene family, isoform CRA_c (Ras-related protein Rab-22A)	Rab22a mCG_13765	187	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	54	H → R in AAK14828 (PubMed:1555775).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AJ311124 mRNA Translation: CAC41378.1 AK031667 mRNA Translation: BAC27501.1 AK146594 mRNA Translation: BAE27289.1 AK150617 mRNA Translation: BAE29707.1 BC006596 mRNA Translation: AAH06596.1 M79304 mRNA Translation: AAK14828.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS38352.1
PIRⁱ	JH0644
NCBI Reference Sequences More...RefSeqⁱ	NP_077756.2, NM_024436.3
UniGeneⁱ	Mm.275304

Genome annotation databases

Ensemblⁱ	ENSMUST00000029024; ENSMUSP00000029024; ENSMUSG00000027519
GeneIDⁱ	19334
KEGGⁱ	mmu:19334
UCSC genome browser More...UCSCⁱ	uc008oed.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P35285	RAB22A, member RAS oncogene family, isoform CRA_a		MOUSE		194	UniRef100_P35285
UPI00001EE896		MOUSE		122

Protein	Similar proteins		Species	Score	Length	Source
P35285	Ras-related protein Rab-22A		HUMAN		194	UniRef90_Q9UL26
Ras-related protein Rab-22A		CANLF		194
RAB22A, member RAS oncogene family		FICAL		241
RAB22A, member RAS oncogene family		PANTR		196
RAB22A protein		BOVIN		194
+100

Protein	Similar proteins		Species	Score	Length	Source
P35285	Ras-related protein Rab-31	)	HUMAN		194	UniRef50_Q13636
Ras-related protein Rab-31		MOUSE		194
Ras-related protein Rab-31		RAT		194
Ras-related protein Rab-22A		CANLF		194
RAB31 isoform 1		PANTR		195
+510

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AJ311124 mRNA Translation: CAC41378.1 AK031667 mRNA Translation: BAC27501.1 AK146594 mRNA Translation: BAE27289.1 AK150617 mRNA Translation: BAE29707.1 BC006596 mRNA Translation: AAH06596.1 M79304 mRNA Translation: AAK14828.1
CCDSⁱ	CCDS38352.1
PIRⁱ	JH0644
RefSeqⁱ	NP_077756.2, NM_024436.3
UniGeneⁱ	Mm.275304

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1YVD	X-ray	1.93	A	3-169	[»]
	1Z0J	X-ray	1.32	A	2-169	[»]
ProteinModelPortalⁱ	P35285
SMRⁱ	P35285
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	202539, 1 interactor
DIPⁱ	DIP-60516N
IntActⁱ	P35285, 35 interactors
MINTⁱ	P35285
STRINGⁱ	10090.ENSMUSP00000029024

PTM databases

iPTMnetⁱ	P35285
PhosphoSitePlusⁱ	P35285

Proteomic databases

EPDⁱ	P35285
PaxDbⁱ	P35285
PeptideAtlasⁱ	P35285
PRIDEⁱ	P35285

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000029024; ENSMUSP00000029024; ENSMUSG00000027519
GeneIDⁱ	19334
KEGGⁱ	mmu:19334
UCSCⁱ	uc008oed.1 mouse

Organism-specific databases

CTDⁱ	57403
MGIⁱ	MGI:105072 Rab22a

Phylogenomic databases

eggNOGⁱ	KOG0092 Eukaryota ENOG410YCCP LUCA
GeneTreeⁱ	ENSGT00760000119101
HOGENOMⁱ	HOG000233968
HOVERGENⁱ	HBG009351
InParanoidⁱ	P35285
KOⁱ	K07891
OMAⁱ	KCDLSDA
OrthoDBⁱ	EOG091G0HKN
PhylomeDBⁱ	P35285
TreeFamⁱ	TF331262

Enzyme and pathway databases

Reactomeⁱ	R-MMU-8873719 RAB geranylgeranylation

Reactomeⁱ

R-MMU-8873719 RAB geranylgeranylation

Miscellaneous databases

EvolutionaryTraceⁱ	P35285
Protein Ontology More...PROⁱ	PR:P35285
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000027519 Expressed in 277 organ(s), highest expression level in humerus cartilage element
CleanExⁱ	MM_RAB22A
ExpressionAtlasⁱ	P35285 baseline and differential
Genevisibleⁱ	P35285 MM

Family and domain databases

InterProⁱ	View protein in InterPro IPR027417 P-loop_NTPase IPR005225 Small_GTP-bd_dom IPR001806 Small_GTPase
Pfamⁱ	View protein in Pfam PF00071 Ras, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR00231 small_GTP, 1 hit
PROSITEⁱ	View protein in PROSITE PS51419 RAB, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RB22A_MOUSE
Accessionⁱ	P35285Primary (citable) accession number: P35285 Secondary accession number(s): Q3UCA7, Q91VD4
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1994
	Last sequence update:	April 26, 2004
	Last modified:	November 7, 2018
	This is version 161 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P35285 (RB22A_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Ras-related protein Rab-22A

Rab22a

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endosome

Plasma membrane

Other locations

Cytoskeleton

Endosome

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ