Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Replication factor C subunit 4

Gene

RFC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.

Miscellaneous

Despite of the presence of a putative ATP-binding motif, this protein does not bind ATP.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi78 – 85ATPSequence analysis8

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processDNA replication
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-110312 Translesion synthesis by REV1
R-HSA-110314 Recognition of DNA damage by PCNA-containing replication complex
R-HSA-110320 Translesion Synthesis by POLH
R-HSA-174411 Polymerase switching on the C-strand of the telomere
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-5651801 PCNA-Dependent Long Patch Base Excision Repair
R-HSA-5655862 Translesion synthesis by POLK
R-HSA-5656121 Translesion synthesis by POLI
R-HSA-5656169 Termination of translesion DNA synthesis
R-HSA-5685938 HDR through Single Strand Annealing (SSA)
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-5696397 Gap-filling DNA repair synthesis and ligation in GG-NER
R-HSA-5696400 Dual Incision in GG-NER
R-HSA-6782135 Dual incision in TC-NER
R-HSA-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-69091 Polymerase switching
R-HSA-69473 G2/M DNA damage checkpoint
SignaLinkiP35249

Names & Taxonomyi

Protein namesi
Recommended name:
Replication factor C subunit 4
Alternative name(s):
Activator 1 37 kDa subunit
Short name:
A1 37 kDa subunit
Activator 1 subunit 4
Replication factor C 37 kDa subunit
Short name:
RF-C 37 kDa subunit
Short name:
RFC37
Gene namesi
Name:RFC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000163918.10
HGNCiHGNC:9972 RFC4
MIMi102577 gene
neXtProtiNX_P35249

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi5984
OpenTargetsiENSG00000163918
PharmGKBiPA34341

Polymorphism and mutation databases

BioMutaiRFC4
DMDMi1703052

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001217571 – 363Replication factor C subunit 4Add BLAST363

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei6N6-acetyllysineCombined sources1
Modified residuei13N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP35249
MaxQBiP35249
PaxDbiP35249
PeptideAtlasiP35249
PRIDEiP35249
ProteomicsDBi55013

PTM databases

iPTMnetiP35249
PhosphoSitePlusiP35249

Expressioni

Gene expression databases

BgeeiENSG00000163918 Expressed in 218 organ(s), highest expression level in heart
CleanExiHS_RFC4
ExpressionAtlasiP35249 baseline and differential
GenevisibleiP35249 HS

Organism-specific databases

HPAiCAB004557
HPA049123
HPA058507

Interactioni

Subunit structurei

Heterotetramer of subunits RFC2, RFC3, RFC4 and RFC5 that can form a complex either with RFC1 or with RAD17. The former interacts with PCNA in the presence of ATP, while the latter has ATPase activity but is not stimulated by PCNA.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111916, 101 interactors
ComplexPortaliCPX-415 DNA replication factor C complex
CORUMiP35249
DIPiDIP-24267N
IntActiP35249, 34 interactors
MINTiP35249
STRINGi9606.ENSP00000296273

Structurei

3D structure databases

ProteinModelPortaliP35249
SMRiP35249
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the activator 1 small subunits family.Curated

Phylogenomic databases

eggNOGiKOG0989 Eukaryota
COG0470 LUCA
GeneTreeiENSGT00550000074917
HOGENOMiHOG000224154
HOVERGENiHBG002053
InParanoidiP35249
KOiK10755
OMAiRQIFGDM
OrthoDBiEOG091G0CKT
PhylomeDBiP35249
TreeFamiTF314424

Family and domain databases

InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR003959 ATPase_AAA_core
IPR008921 DNA_pol3_clamp-load_cplx_C
IPR027417 P-loop_NTPase
IPR013748 Rep_factorC_C
PfamiView protein in Pfam
PF00004 AAA, 1 hit
PF08542 Rep_fac_C, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF48019 SSF48019, 1 hit
SSF52540 SSF52540, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P35249-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAFLKGTSI STKPPLTKDR GVAASAGSSG ENKKAKPVPW VEKYRPKCVD
60 70 80 90 100
EVAFQEEVVA VLKKSLEGAD LPNLLFYGPP GTGKTSTILA AARELFGPEL
110 120 130 140 150
FRLRVLELNA SDERGIQVVR EKVKNFAQLT VSGSRSDGKP CPPFKIVILD
160 170 180 190 200
EADSMTSAAQ AALRRTMEKE SKTTRFCLIC NYVSRIIEPL TSRCSKFRFK
210 220 230 240 250
PLSDKIQQQR LLDIAKKENV KISDEGIAYL VKVSEGDLRK AITFLQSATR
260 270 280 290 300
LTGGKEITEK VITDIAGVIP AEKIDGVFAA CQSGSFDKLE AVVKDLIDEG
310 320 330 340 350
HAATQLVNQL HDVVVENNLS DKQKSIITEK LAEVDKCLAD GADEHLQLIS
360
LCATVMQQLS QNC
Length:363
Mass (Da):39,682
Last modified:October 1, 1996 - v2
Checksum:i6FEAB3794379F3E0
GO
Isoform 2 (identifier: P35249-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-303: IPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAA → RVLDILNFFLVGFFVAFRKFSSNKYWVFSKCQVLH
     304-363: Missing.

Note: No experimental confirmation available.
Show »
Length:303
Mass (Da):33,675
Checksum:i145BFD9762926E18
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JZI1C9JZI1_HUMAN
Replication factor C subunit 4
RFC4
336Annotation score:
H7C1P0H7C1P0_HUMAN
Replication factor C subunit 4
RFC4
111Annotation score:
C9J8M3C9J8M3_HUMAN
Replication factor C subunit 4
RFC4
214Annotation score:
C9JTT7C9JTT7_HUMAN
Replication factor C subunit 4
RFC4
167Annotation score:
C9JXZ7C9JXZ7_HUMAN
Replication factor C subunit 4
RFC4
123Annotation score:
C9JGY5C9JGY5_HUMAN
Replication factor C subunit 4
RFC4
95Annotation score:
F8WE44F8WE44_HUMAN
Replication factor C subunit 4
RFC4
97Annotation score:
C9JW34C9JW34_HUMAN
Replication factor C subunit 4
RFC4
43Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_014307292V → A1 PublicationCorresponds to variant dbSNP:rs2066497Ensembl.1
Natural variantiVAR_036121354T → S in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055862269 – 303IPAEK…EGHAA → RVLDILNFFLVGFFVAFRKF SSNKYWVFSKCQVLH in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_055863304 – 363Missing in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M87339 mRNA Translation: AAB09785.1
AF538718 Genomic DNA Translation: AAM97933.1
BT006987 mRNA Translation: AAP35633.1
AK297282 mRNA Translation: BAG59753.1
CR536561 mRNA Translation: CAG38798.1
CH471052 Genomic DNA Translation: EAW78169.1
CH471052 Genomic DNA Translation: EAW78170.1
CH471052 Genomic DNA Translation: EAW78171.1
BC017452 mRNA Translation: AAH17452.1
BC024022 mRNA Translation: AAH24022.1
CCDSiCCDS3283.1 [P35249-1]
PIRiA45253
RefSeqiNP_002907.1, NM_002916.3 [P35249-1]
NP_853551.1, NM_181573.2 [P35249-1]
UniGeneiHs.732098

Genome annotation databases

EnsembliENST00000296273; ENSP00000296273; ENSG00000163918 [P35249-1]
ENST00000392481; ENSP00000376272; ENSG00000163918 [P35249-1]
GeneIDi5984
KEGGihsa:5984
UCSCiuc003fqz.4 human [P35249-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M87339 mRNA Translation: AAB09785.1
AF538718 Genomic DNA Translation: AAM97933.1
BT006987 mRNA Translation: AAP35633.1
AK297282 mRNA Translation: BAG59753.1
CR536561 mRNA Translation: CAG38798.1
CH471052 Genomic DNA Translation: EAW78169.1
CH471052 Genomic DNA Translation: EAW78170.1
CH471052 Genomic DNA Translation: EAW78171.1
BC017452 mRNA Translation: AAH17452.1
BC024022 mRNA Translation: AAH24022.1
CCDSiCCDS3283.1 [P35249-1]
PIRiA45253
RefSeqiNP_002907.1, NM_002916.3 [P35249-1]
NP_853551.1, NM_181573.2 [P35249-1]
UniGeneiHs.732098

3D structure databases

ProteinModelPortaliP35249
SMRiP35249
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111916, 101 interactors
ComplexPortaliCPX-415 DNA replication factor C complex
CORUMiP35249
DIPiDIP-24267N
IntActiP35249, 34 interactors
MINTiP35249
STRINGi9606.ENSP00000296273

PTM databases

iPTMnetiP35249
PhosphoSitePlusiP35249

Polymorphism and mutation databases

BioMutaiRFC4
DMDMi1703052

Proteomic databases

EPDiP35249
MaxQBiP35249
PaxDbiP35249
PeptideAtlasiP35249
PRIDEiP35249
ProteomicsDBi55013

Protocols and materials databases

DNASUi5984
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296273; ENSP00000296273; ENSG00000163918 [P35249-1]
ENST00000392481; ENSP00000376272; ENSG00000163918 [P35249-1]
GeneIDi5984
KEGGihsa:5984
UCSCiuc003fqz.4 human [P35249-1]

Organism-specific databases

CTDi5984
DisGeNETi5984
EuPathDBiHostDB:ENSG00000163918.10
GeneCardsiRFC4
HGNCiHGNC:9972 RFC4
HPAiCAB004557
HPA049123
HPA058507
MIMi102577 gene
neXtProtiNX_P35249
OpenTargetsiENSG00000163918
PharmGKBiPA34341
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0989 Eukaryota
COG0470 LUCA
GeneTreeiENSGT00550000074917
HOGENOMiHOG000224154
HOVERGENiHBG002053
InParanoidiP35249
KOiK10755
OMAiRQIFGDM
OrthoDBiEOG091G0CKT
PhylomeDBiP35249
TreeFamiTF314424

Enzyme and pathway databases

ReactomeiR-HSA-110312 Translesion synthesis by REV1
R-HSA-110314 Recognition of DNA damage by PCNA-containing replication complex
R-HSA-110320 Translesion Synthesis by POLH
R-HSA-174411 Polymerase switching on the C-strand of the telomere
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-5651801 PCNA-Dependent Long Patch Base Excision Repair
R-HSA-5655862 Translesion synthesis by POLK
R-HSA-5656121 Translesion synthesis by POLI
R-HSA-5656169 Termination of translesion DNA synthesis
R-HSA-5685938 HDR through Single Strand Annealing (SSA)
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-5696397 Gap-filling DNA repair synthesis and ligation in GG-NER
R-HSA-5696400 Dual Incision in GG-NER
R-HSA-6782135 Dual incision in TC-NER
R-HSA-6782210 Gap-filling DNA repair synthesis and ligation in TC-NER
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-69091 Polymerase switching
R-HSA-69473 G2/M DNA damage checkpoint
SignaLinkiP35249

Miscellaneous databases

ChiTaRSiRFC4 human
GeneWikiiRFC4
GenomeRNAii5984
PROiPR:P35249
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163918 Expressed in 218 organ(s), highest expression level in heart
CleanExiHS_RFC4
ExpressionAtlasiP35249 baseline and differential
GenevisibleiP35249 HS

Family and domain databases

InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR003959 ATPase_AAA_core
IPR008921 DNA_pol3_clamp-load_cplx_C
IPR027417 P-loop_NTPase
IPR013748 Rep_factorC_C
PfamiView protein in Pfam
PF00004 AAA, 1 hit
PF08542 Rep_fac_C, 1 hit
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SUPFAMiSSF48019 SSF48019, 1 hit
SSF52540 SSF52540, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRFC4_HUMAN
AccessioniPrimary (citable) accession number: P35249
Secondary accession number(s): B4DM41, D3DNV2, Q6FHX7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: October 1, 1996
Last modified: November 7, 2018
This is version 190 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again