UniProtKB - P35237 (SPB6_HUMAN)

BLAST

>sp|P35237|SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFN
KSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEE
LDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKE
NTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTD
LRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
DFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCADHPFLFFIQ
HSKTNGILFCGRFSSP

Align
Format
Add to basket Added to basket
History
Entry version 178 (10 Oct 2018)
Sequence version 3 (04 Dec 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Serpin B6

Gene

SERPINB6

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

May be involved in the regulation of serine proteinases present in the brain or extravasated from the blood (By similarity). Inhibitor of cathepsin G, kallikrein-8 and thrombin. May play an important role in the inner ear in the protection against leakage of lysosomal content during stress and loss of this protection results in cell death and sensorineural hearing loss.By similarity5 Publications

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Siteⁱ	341 – 342	Reactive bond		2

GO - Molecular functionⁱ

protease binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 14670919
serine-type endopeptidase inhibitor activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 17761692

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular response to osmotic stress
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 20451170
negative regulation of endopeptidase activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 17761692
neutrophil degranulation Source: Reactome
sensory perception of sound
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 20451170

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Protease inhibitor, Serine protease inhibitor

Molecular function

Protease inhibitor, Serine protease inhibitor

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation R-HSA-75205 Dissolution of Fibrin Clot

Reactomeⁱ

R-HSA-6798695 Neutrophil degranulation
R-HSA-75205 Dissolution of Fibrin Clot

Protein family/group databases

MEROPS protease database More...MEROPSⁱ	I04.011

MEROPSⁱ

I04.011

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Serpin B6 Alternative name(s): Cytoplasmic antiproteinase Short name: CAP Peptidase inhibitor 6 Short name: PI-6 Placental thrombin inhibitor
Gene namesⁱ	Name:SERPINB6 Synonyms:PI6, PTI
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 6

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000124570.17
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:8950 SERPINB6
MIMⁱ	173321 gene
neXtProtⁱ	NX_P35237

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Deafness, autosomal recessive, 91 (DFNB91)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA form of non-syndromic deafness characterized by progressive and age-dependent sensorineural hearing loss. Vestibular function is normal.

Keywords - Diseaseⁱ

Deafness, Non-syndromic deafness

Organism-specific databases

DisGeNET More...DisGeNETⁱ	5269
MalaCards human disease database More...MalaCardsⁱ	SERPINB6
MIMⁱ	613453 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000124570
Orphanetⁱ	90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB
PharmGKBⁱ	PA35516

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB00055 Drotrecogin alfa

DrugBankⁱ

DB00055 Drotrecogin alfa

Polymorphism and mutation databases

BioMutaⁱ	SERPINB6
DMDMⁱ	161784343

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000094106	1 – 376	Serpin B6Add BLAST		376

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	1	N-acetylmethionineCombined sources	1
Modified residueⁱ	151	PhosphoserineCombined sources	1
Modified residueⁱ	195	N6-acetyllysineBy similarity	1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	P35237
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P35237
PaxDbⁱ	P35237
PeptideAtlas More...PeptideAtlasⁱ	P35237
PRIDEⁱ	P35237
ProteomicsDBⁱ	54998

2D gel databases

USC-OGP 2-DE database More...OGPⁱ	P35237

OGPⁱ

P35237

PTM databases

iPTMnetⁱ	P35237
PhosphoSitePlusⁱ	P35237
SwissPalmⁱ	P35237

Expressionⁱ

Tissue specificityⁱ

Expressed in keratinocytes (at protein level). Highest levels in skeletal muscle. Also found in placenta, cardiac muscle, lung, liver, kidney and pancreas. Expressed in the inner ear hair cells. Expressed abundantly by normal mast cells in different tissues and by mast cells in mastocytoma lesions.3 Publications

Gene expression databases

Bgeeⁱ	ENSG00000124570 Expressed in 226 organ(s), highest expression level in right testis
CleanExⁱ	HS_SERPINB6
ExpressionAtlasⁱ	P35237 baseline and differential
Genevisibleⁱ	P35237 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA009668 HPA012736

HPAⁱ

HPA009668
HPA012736

Interactionⁱ

Subunit structureⁱ

Forms a complex with the monomeric form of beta-tryptase.

GO - Molecular functionⁱ

protease binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 14670919

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	111287, 15 interactors
IntActⁱ	P35237, 1 interactor
STRINGⁱ	9606.ENSP00000338358

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P35237
SMRⁱ	P35237
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the serpin family. Ov-serpin subfamily.Curated

Phylogenomic databases

eggNOGⁱ	KOG2392 Eukaryota COG4826 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000118789
HOGENOMⁱ	HOG000238519
HOVERGENⁱ	HBG005957
InParanoidⁱ	P35237
KEGG Orthology (KO) More...KOⁱ	K13963
PhylomeDBⁱ	P35237
TreeFamⁱ	TF352619

Family and domain databases

InterProⁱ	View protein in InterPro IPR023795 Serpin_CS IPR023796 Serpin_dom IPR000215 Serpin_fam IPR036186 Serpin_sf
PANTHERⁱ	PTHR11461 PTHR11461, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00079 Serpin, 1 hit
SMARTⁱ	View protein in SMART SM00093 SERPIN, 1 hit
SUPFAMⁱ	SSF56574 SSF56574, 1 hit
PROSITEⁱ	View protein in PROSITE PS00284 SERPIN, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 10 potential isoforms that are computationally mapped.Show all Align All

P35237-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MDVLAEANGT FALNLLKTLG KDNSKNVFFS PMSMSCALAM VYMGAKGNTA 
        60         70         80         90        100
AQMAQILSFN KSGGGGDIHQ GFQSLLTEVN KTGTQYLLRM ANRLFGEKSC 
       110        120        130        140        150
DFLSSFRDSC QKFYQAEMEE LDFISAVEKS RKHINTWVAE KTEGKIAELL 
       160        170        180        190        200
SPGSVDPLTR LVLVNAVYFR GNWDEQFDKE NTEERLFKVS KNEEKPVQMM 
       210        220        230        240        250
FKQSTFKKTY IGEIFTQILV LPYVGKELNM IIMLPDETTD LRTVEKELTY 
       260        270        280        290        300
EKFVEWTRLD MMDEEEVEVS LPRFKLEESY DMESVLRNLG MTDAFELGKA 
       310        320        330        340        350
DFSGMSQTDL SLSKVVHKSF VEVNEEGTEA AAATAAIMMM RCARFVPRFC 
       360        370 
ADHPFLFFIQ HSKTNGILFC GRFSSP

Length:376

Mass (Da):42,622

Last modified:December 4, 2007 - v3

Checksum:ⁱ3A06BC26A7510E1A

Computationally mapped potential isoform sequencesⁱ

There are 10 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A2R8Y5S1	A0A2R8Y5S1_HUMAN	Serpin B6 Serpin B6	SERPINB6	60	Annotation score:
A0A2R8YDD0	A0A2R8YDD0_HUMAN	Serpin B6 Serpin B6	SERPINB6	61	Annotation score:
A0A087X1N8	A0A087X1N8_HUMAN	Serpin B6 Serpin B6 (Serpin peptidase inhibitor, clade B (Ovalbumin), member 6, isoform CRA_e)	SERPINB6 hCG_22875	395	Annotation score:
A0A024QZX5	A0A024QZX5_HUMAN	Serpin B6 Serpin B6 (Serpin peptidase inhibitor, clade B (Ovalbumin), member 6, isoform CRA_d)	SERPINB6 hCG_22875	380	Annotation score:
A0A2R8YD12	A0A2R8YD12_HUMAN	Serpin B6 Serpin B6	SERPINB6	332	Annotation score:
A0A2R8Y6A7	A0A2R8Y6A7_HUMAN	Serpin B6 Serpin B6	SERPINB6	171	Annotation score:
A0A2R8Y6N4	A0A2R8Y6N4_HUMAN	Serpin B6 Serpin B6	SERPINB6	81	Annotation score:
A0A2R8Y517	A0A2R8Y517_HUMAN	Serpin B6 Serpin B6	SERPINB6	77	Annotation score:
A0A2R8Y7E5	A0A2R8Y7E5_HUMAN	Serpin B6 Serpin B6	SERPINB6	17	Annotation score:
A0A2R8Y5Y8	A0A2R8Y5Y8_HUMAN	Serpin B6 Serpin B6	SERPINB6	11	Annotation score:

Sequence cautionⁱ

The sequence BAD92800 differs from that shown. Reason: Erroneous initiation.Curated

The sequence CAD98106 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	175	E → G in CAA80373 (PubMed:8415716).Curated	1
Sequence conflictⁱ	200	M → V in BAG37155 (PubMed:14702039).Curated	1
Sequence conflictⁱ	362	S → R in CAA80373 (PubMed:8415716).Curated	1

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_037295	90	M → V4 PublicationsCorresponds to variant dbSNP:rs2295769EnsemblClinVar.		1
Natural variantⁱVAR_037296	153	G → S. Corresponds to variant dbSNP:rs2295766EnsemblClinVar.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Z22658 mRNA Translation: CAA80373.1 S69272 mRNA Translation: AAB30320.1 AK314578 mRNA Translation: BAG37155.1 BX538343 mRNA Translation: CAD98106.1 Different initiation. AL133351 Genomic DNA No translation available. CH471087 Genomic DNA Translation: EAW55097.1 BC001394 mRNA Translation: AAH01394.1 BC098564 mRNA Translation: AAH98564.1 AB209563 mRNA Translation: BAD92800.1 Different initiation.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS4479.1
PIRⁱ	A48681
NCBI Reference Sequences More...RefSeqⁱ	NP_001182220.2, NM_001195291.2 NP_001258751.1, NM_001271822.1 NP_001258752.1, NM_001271823.1 NP_001258753.1, NM_001271824.1 NP_001258754.1, NM_001271825.1 NP_001284628.1, NM_001297699.1 NP_001284629.1, NM_001297700.1 NP_004559.4, NM_004568.5 XP_011512975.1, XM_011514673.1 XP_011512976.1, XM_011514674.2
UniGeneⁱ	Hs.519523 Hs.731506

Genome annotation databases

Ensemblⁱ	ENST00000335686; ENSP00000338358; ENSG00000124570 ENST00000380520; ENSP00000369891; ENSG00000124570 ENST00000380524; ENSP00000369896; ENSG00000124570 ENST00000380529; ENSP00000369901; ENSG00000124570 ENST00000380539; ENSP00000369912; ENSG00000124570 ENST00000380546; ENSP00000369919; ENSG00000124570 ENST00000643098; ENSP00000493936; ENSG00000124570 ENST00000644178; ENSP00000496073; ENSG00000124570 ENST00000644388; ENSP00000494650; ENSG00000124570
GeneIDⁱ	5269
KEGGⁱ	hsa:5269
UCSC genome browser More...UCSCⁱ	uc003muk.3 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P35237	MSTP057		HUMAN		259	UniRef100_P35237
Serpin family B member 6		GORGO		376
Serpin B6 (Fragment)		HUMAN		60
Serpin B6 (Fragment)		HUMAN		11
Serpin B6 (Fragment)		HUMAN		77
+4

Protein	Similar proteins		Species	Score	Length	Source
P35237	Serpin B6		MACFA		376	UniRef90_P35237
Serpin B6		PONAB		376
MSTP057		HUMAN		259
Serpin family B member 6		GORGO		376
Uncharacterized protein		PANPA		412
+60

Protein	Similar proteins		Species	Score	Length	Source
P35237	Serpin B6		MACFA		376	UniRef50_P35237
Serpin B6		PONAB		376
MSTP057		HUMAN		259
Serpin family B member 6		GORGO		376
Uncharacterized protein		PANPA		412
+127

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Z22658 mRNA Translation: CAA80373.1 S69272 mRNA Translation: AAB30320.1 AK314578 mRNA Translation: BAG37155.1 BX538343 mRNA Translation: CAD98106.1 Different initiation. AL133351 Genomic DNA No translation available. CH471087 Genomic DNA Translation: EAW55097.1 BC001394 mRNA Translation: AAH01394.1 BC098564 mRNA Translation: AAH98564.1 AB209563 mRNA Translation: BAD92800.1 Different initiation.
CCDSⁱ	CCDS4479.1
PIRⁱ	A48681
RefSeqⁱ	NP_001182220.2, NM_001195291.2 NP_001258751.1, NM_001271822.1 NP_001258752.1, NM_001271823.1 NP_001258753.1, NM_001271824.1 NP_001258754.1, NM_001271825.1 NP_001284628.1, NM_001297699.1 NP_001284629.1, NM_001297700.1 NP_004559.4, NM_004568.5 XP_011512975.1, XM_011514673.1 XP_011512976.1, XM_011514674.2
UniGeneⁱ	Hs.519523 Hs.731506

3D structure databases

ProteinModelPortalⁱ	P35237
SMRⁱ	P35237
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	111287, 15 interactors
IntActⁱ	P35237, 1 interactor
STRINGⁱ	9606.ENSP00000338358

Chemistry databases

DrugBankⁱ	DB00055 Drotrecogin alfa

DrugBankⁱ

DB00055 Drotrecogin alfa

Protein family/group databases

MEROPSⁱ	I04.011

MEROPSⁱ

I04.011

PTM databases

iPTMnetⁱ	P35237
PhosphoSitePlusⁱ	P35237
SwissPalmⁱ	P35237

Polymorphism and mutation databases

BioMutaⁱ	SERPINB6
DMDMⁱ	161784343

2D gel databases

OGPⁱ	P35237

OGPⁱ

P35237

Proteomic databases

EPDⁱ	P35237
MaxQBⁱ	P35237
PaxDbⁱ	P35237
PeptideAtlasⁱ	P35237
PRIDEⁱ	P35237
ProteomicsDBⁱ	54998

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	5269
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000335686; ENSP00000338358; ENSG00000124570 ENST00000380520; ENSP00000369891; ENSG00000124570 ENST00000380524; ENSP00000369896; ENSG00000124570 ENST00000380529; ENSP00000369901; ENSG00000124570 ENST00000380539; ENSP00000369912; ENSG00000124570 ENST00000380546; ENSP00000369919; ENSG00000124570 ENST00000643098; ENSP00000493936; ENSG00000124570 ENST00000644178; ENSP00000496073; ENSG00000124570 ENST00000644388; ENSP00000494650; ENSG00000124570
GeneIDⁱ	5269
KEGGⁱ	hsa:5269
UCSCⁱ	uc003muk.3 human

Organism-specific databases

CTDⁱ	5269
DisGeNETⁱ	5269
EuPathDBⁱ	HostDB:ENSG00000124570.17
GeneCardsⁱ	SERPINB6
H-InvDBⁱ	HIX0005534
HGNCⁱ	HGNC:8950 SERPINB6
HPAⁱ	HPA009668 HPA012736
MalaCardsⁱ	SERPINB6
MIMⁱ	173321 gene 613453 phenotype
neXtProtⁱ	NX_P35237
OpenTargetsⁱ	ENSG00000124570
Orphanetⁱ	90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB
PharmGKBⁱ	PA35516
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2392 Eukaryota COG4826 LUCA
GeneTreeⁱ	ENSGT00760000118789
HOGENOMⁱ	HOG000238519
HOVERGENⁱ	HBG005957
InParanoidⁱ	P35237
KOⁱ	K13963
PhylomeDBⁱ	P35237
TreeFamⁱ	TF352619

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation R-HSA-75205 Dissolution of Fibrin Clot

Reactomeⁱ

R-HSA-6798695 Neutrophil degranulation
R-HSA-75205 Dissolution of Fibrin Clot

Miscellaneous databases

ChiTaRSⁱ	SERPINB6 human
GeneWikiⁱ	SERPINB6
GenomeRNAiⁱ	5269
Protein Ontology More...PROⁱ	PR:P35237
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000124570 Expressed in 226 organ(s), highest expression level in right testis
CleanExⁱ	HS_SERPINB6
ExpressionAtlasⁱ	P35237 baseline and differential
Genevisibleⁱ	P35237 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR023795 Serpin_CS IPR023796 Serpin_dom IPR000215 Serpin_fam IPR036186 Serpin_sf
PANTHERⁱ	PTHR11461 PTHR11461, 1 hit
Pfamⁱ	View protein in Pfam PF00079 Serpin, 1 hit
SMARTⁱ	View protein in SMART SM00093 SERPIN, 1 hit
SUPFAMⁱ	SSF56574 SSF56574, 1 hit
PROSITEⁱ	View protein in PROSITE PS00284 SERPIN, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	SPB6_HUMAN
Accessionⁱ	P35237Primary (citable) accession number: P35237 Secondary accession number(s): B2RBA8 , Q59F97, Q5TD06, Q7Z2Y7, Q96J44, Q9UDI7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1994
	Last sequence update:	December 4, 2007
	Last modified:	October 10, 2018
	This is version 178 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 6
Human chromosome 6: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P35237 (SPB6_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Serpin B6

SERPINB6

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Extracellular region or secreted

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Keywords - Diseasei

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

2D gel databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ