Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 189 (12 Aug 2020)
Sequence version 3 (23 Jan 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tyrosine-protein phosphatase non-receptor type 7

Gene

PTPN7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein phosphatase that acts preferentially on tyrosine-phosphorylated MAPK1. Plays a role in the regulation of T and B-lymphocyte development and signal transduction.6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited in cells after FCER1A triggering.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei257Substrate1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei291Phosphocysteine intermediatePROSITE-ProRule annotation1 Publication1
Binding sitei335Substrate1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.48, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P35236

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-9008059, Interleukin-37 signaling

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
P35236

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P35236

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 7 (EC:3.1.3.48)
Alternative name(s):
Hematopoietic protein-tyrosine phosphatase
Short name:
HEPTP
Protein-tyrosine phosphatase LC-PTP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTPN7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143851.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9659, PTPN7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
176889, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P35236

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi44S → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation. 1 Publication1
Mutagenesisi44S → D: Reduces binding of MAP kinase. 1 Publication1
Mutagenesisi66T → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation; when associated with A-93. 1 Publication1
Mutagenesisi93S → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation; when associated with A-66. 1 Publication1
Mutagenesisi125Y → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi257D → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi291C → S: Loss of catalytic activity. 1 Publication1
Mutagenesisi335Q → A: Reduced catalytic activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
5778

Open Targets

More...
OpenTargetsi
ENSG00000143851

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34003

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P35236, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2219

DrugCentral

More...
DrugCentrali
P35236

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PTPN7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20141721

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000947611 – 360Tyrosine-protein phosphatase non-receptor type 7Add BLAST360

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei44PhosphoserineCombined sources2 Publications1
Modified residuei66PhosphothreonineCombined sources1 Publication1
Modified residuei93Phosphoserine1 Publication1
Modified residuei110PhosphoserineCombined sources1
Modified residuei143PhosphoserineCombined sources1
Modified residuei291Cysteine sulfenic acid (-SOH)By similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine residues in resting T-cells. Phosphorylation increases upon exposure to stimuli that increase intracellular cAMP levels. Phosphorylation leads to dissociation of bound MAP kinases.3 Publications
Oxidized at active site cysteine. Treatment with pervanadate (vanadate and H2O2) or with antigen enhanced oxidation of active site cysteine (By similarity).By similarity

Keywords - PTMi

Oxidation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P35236

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P35236

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P35236

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P35236

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P35236

PeptideAtlas

More...
PeptideAtlasi
P35236

PRoteomics IDEntifications database

More...
PRIDEi
P35236

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
54996 [P35236-1]
54997 [P35236-2]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
PTPN7

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P35236

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P35236

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed exclusively in thymus and spleen.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143851, Expressed in bone marrow and 153 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P35236, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P35236, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000143851, Tissue enhanced (bone marrow, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

Interacts with MAPK1, MAPK3 and several other MAP kinases.

7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
111743, 63 interactors

Database of interacting proteins

More...
DIPi
DIP-29118N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P35236

Protein interaction database and analysis system

More...
IntActi
P35236, 18 interactors

Molecular INTeraction database

More...
MINTi
P35236

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000309116

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P35236

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P35236, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1360
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P35236

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P35236

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini97 – 350Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST254

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni38 – 51Interaction with MAP kinasesAdd BLAST14
Regioni291 – 297Substrate binding7

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0789, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160979

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001645_10_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P35236

KEGG Orthology (KO)

More...
KOi
K18019

Database of Orthologous Groups

More...
OrthoDBi
411281at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P35236

TreeFam database of animal gene trees

More...
TreeFami
TF331016

Family and domain databases

Database of protein disorder

More...
DisProti
DP01646

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.90.190.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...
IDEALi
IID00617

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029021, Prot-tyrosine_phosphatase-like
IPR000242, PTPase_domain
IPR016130, Tyr_Pase_AS
IPR003595, Tyr_Pase_cat
IPR008356, Tyr_Pase_KIM-con
IPR000387, TYR_PHOSPHATASE_dom

The PANTHER Classification System

More...
PANTHERi
PTHR46198, PTHR46198, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00102, Y_phosphatase, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01778, KIMPTPASE
PR00700, PRTYPHPHTASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00194, PTPc, 1 hit
SM00404, PTPc_motif, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799, SSF52799, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00383, TYR_PHOSPHATASE_1, 1 hit
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50055, TYR_PHOSPHATASE_PTP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P35236-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQAHGGRSR AQPLTLSLGA AMTQPPPEKT PAKKHVRLQE RRGSNVALML
60 70 80 90 100
DVRSLGAVEP ICSVNTPREV TLHFLRTAGH PLTRWALQRQ PPSPKQLEEE
110 120 130 140 150
FLKIPSNFVS PEDLDIPGHA SKDRYKTILP NPQSRVCLGR AQSQEDGDYI
160 170 180 190 200
NANYIRGYDG KEKVYIATQG PMPNTVSDFW EMVWQEEVSL IVMLTQLREG
210 220 230 240 250
KEKCVHYWPT EEETYGPFQI RIQDMKECPE YTVRQLTIQY QEERRSVKHI
260 270 280 290 300
LFSAWPDHQT PESAGPLLRL VAEVEESPET AAHPGPIVVH CSAGIGRTGC
310 320 330 340 350
FIATRIGCQQ LKARGEVDIL GIVCQLRLDR GGMIQTAEQY QFLHHTLALY
360
AGQLPEEPSP
Length:360
Mass (Da):40,529
Last modified:January 23, 2002 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i388A154CC55AC0EE
GO
Isoform 2 (identifier: P35236-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGASFWPIRQAREQQRRALSFRQTSWLSEPPLGPAPHLSM

Show »
Length:399
Mass (Da):45,002
Checksum:i16690FDF358E20C8
GO
Isoform 3 (identifier: P35236-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVGKAWPLTH...PLGPAPHLSM

Show »
Length:465
Mass (Da):52,284
Checksum:iAB2E025ECD392906
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KR55J3KR55_HUMAN
Protein-tyrosine-phosphatase
PTPN7
441Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EUM0E7EUM0_HUMAN
Protein-tyrosine-phosphatase
PTPN7
154Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WF66F8WF66_HUMAN
Protein-tyrosine-phosphatase
PTPN7
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4T8H7C4T8_HUMAN
Protein-tyrosine-phosphatase
PTPN7
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5I3H7C5I3_HUMAN
Protein-tyrosine-phosphatase
PTPN7
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IYI6C9IYI6_HUMAN
Protein-tyrosine-phosphatase
PTPN7
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PE54E9PE54_HUMAN
Protein-tyrosine-phosphatase
PTPN7
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JBA9C9JBA9_HUMAN
Protein-tyrosine-phosphatase
PTPN7
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEY3F8WEY3_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JAW7C9JAW7_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA59531 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti235 – 236QL → HV in AAA59531 (PubMed:1530918).Curated2
Sequence conflicti337A → D in BAA01946 (PubMed:1510684).Curated1
Isoform 3 (identifier: P35236-3)
Sequence conflicti37Q → R in BAG54453 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0269251M → MGASFWPIRQAREQQRRALS FRQTSWLSEPPLGPAPHLSM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0472751M → MVGKAWPLTHSQGTGPWAPE GHRREAADPWWQRQQAQEGR MQLGCAWVAARRGGGRKLAS WSLLSPQRQTDRQTDSWQEA AWGPQLLQQTSWLSEPPLGP APHLSM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D11327 mRNA Translation: BAA01946.1
M64322 mRNA Translation: AAA59531.1 Frameshift.
BT009848 mRNA Translation: AAP88850.1
AK127214 mRNA Translation: BAG54453.1
AL592300 Genomic DNA No translation available.
BC001746 mRNA Translation: AAH01746.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1422.1 [P35236-2]
CCDS1423.2 [P35236-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
JH0692

NCBI Reference Sequences

More...
RefSeqi
NP_002823.3, NM_002832.3 [P35236-3]
NP_542155.1, NM_080588.2 [P35236-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309017; ENSP00000309116; ENSG00000143851 [P35236-3]
ENST00000367279; ENSP00000356248; ENSG00000143851 [P35236-2]
ENST00000495688; ENSP00000420506; ENSG00000143851 [P35236-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5778

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5778

UCSC genome browser

More...
UCSCi
uc001gxl.2, human [P35236-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D11327 mRNA Translation: BAA01946.1
M64322 mRNA Translation: AAA59531.1 Frameshift.
BT009848 mRNA Translation: AAP88850.1
AK127214 mRNA Translation: BAG54453.1
AL592300 Genomic DNA No translation available.
BC001746 mRNA Translation: AAH01746.2
CCDSiCCDS1422.1 [P35236-2]
CCDS1423.2 [P35236-3]
PIRiJH0692
RefSeqiNP_002823.3, NM_002832.3 [P35236-3]
NP_542155.1, NM_080588.2 [P35236-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZC0X-ray1.85A65-360[»]
2A3KX-ray2.55A65-358[»]
2GP0X-ray2.05A65-360[»]
2GPHX-ray1.90B37-52[»]
2HVLX-ray2.40A65-360[»]
2QDCX-ray2.00A65-360[»]
2QDMX-ray2.05A65-360[»]
2QDPX-ray2.72A65-360[»]
3D42X-ray2.46A65-360[»]
3D44X-ray1.90A65-360[»]
3O4SX-ray1.90A65-360[»]
3O4TX-ray2.60A65-360[»]
3O4UX-ray2.25A65-360[»]
SMRiP35236
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111743, 63 interactors
DIPiDIP-29118N
ELMiP35236
IntActiP35236, 18 interactors
MINTiP35236
STRINGi9606.ENSP00000309116

Chemistry databases

BindingDBiP35236
ChEMBLiCHEMBL2219
DrugCentraliP35236

PTM databases

DEPODiPTPN7
iPTMnetiP35236
PhosphoSitePlusiP35236

Polymorphism and mutation databases

BioMutaiPTPN7
DMDMi20141721

Proteomic databases

EPDiP35236
jPOSTiP35236
MassIVEiP35236
MaxQBiP35236
PaxDbiP35236
PeptideAtlasiP35236
PRIDEiP35236
ProteomicsDBi54996 [P35236-1]
54997 [P35236-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
20651, 332 antibodies

The DNASU plasmid repository

More...
DNASUi
5778

Genome annotation databases

EnsembliENST00000309017; ENSP00000309116; ENSG00000143851 [P35236-3]
ENST00000367279; ENSP00000356248; ENSG00000143851 [P35236-2]
ENST00000495688; ENSP00000420506; ENSG00000143851 [P35236-1]
GeneIDi5778
KEGGihsa:5778
UCSCiuc001gxl.2, human [P35236-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5778
DisGeNETi5778
EuPathDBiHostDB:ENSG00000143851.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PTPN7
HGNCiHGNC:9659, PTPN7
HPAiENSG00000143851, Tissue enhanced (bone marrow, lymphoid tissue)
MIMi176889, gene
neXtProtiNX_P35236
OpenTargetsiENSG00000143851
PharmGKBiPA34003

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0789, Eukaryota
GeneTreeiENSGT00940000160979
HOGENOMiCLU_001645_10_3_1
InParanoidiP35236
KOiK18019
OrthoDBi411281at2759
PhylomeDBiP35236
TreeFamiTF331016

Enzyme and pathway databases

BRENDAi3.1.3.48, 2681
PathwayCommonsiP35236
ReactomeiR-HSA-9008059, Interleukin-37 signaling
SABIO-RKiP35236
SIGNORiP35236

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
5778, 17 hits in 870 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PTPN7, human
EvolutionaryTraceiP35236

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PTPN7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5778
PharosiP35236, Tchem

Protein Ontology

More...
PROi
PR:P35236
RNActiP35236, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143851, Expressed in bone marrow and 153 other tissues
ExpressionAtlasiP35236, baseline and differential
GenevisibleiP35236, HS

Family and domain databases

DisProtiDP01646
Gene3Di3.90.190.10, 1 hit
IDEALiIID00617
InterProiView protein in InterPro
IPR029021, Prot-tyrosine_phosphatase-like
IPR000242, PTPase_domain
IPR016130, Tyr_Pase_AS
IPR003595, Tyr_Pase_cat
IPR008356, Tyr_Pase_KIM-con
IPR000387, TYR_PHOSPHATASE_dom
PANTHERiPTHR46198, PTHR46198, 1 hit
PfamiView protein in Pfam
PF00102, Y_phosphatase, 1 hit
PRINTSiPR01778, KIMPTPASE
PR00700, PRTYPHPHTASE
SMARTiView protein in SMART
SM00194, PTPc, 1 hit
SM00404, PTPc_motif, 1 hit
SUPFAMiSSF52799, SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383, TYR_PHOSPHATASE_1, 1 hit
PS50056, TYR_PHOSPHATASE_2, 1 hit
PS50055, TYR_PHOSPHATASE_PTP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTN7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35236
Secondary accession number(s): B3KXE1
, Q53XK4, Q5SXQ0, Q5SXQ1, Q9BV05
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2002
Last modified: August 12, 2020
This is version 189 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again