Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tyrosine-protein phosphatase non-receptor type 7

Gene

PTPN7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Protein phosphatase that acts preferentially on tyrosine-phosphorylated MAPK1. Plays a role in the regulation of T and B-lymphocyte development and signal transduction.6 Publications

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation

Activity regulationi

Inhibited in cells after FCER1A triggering.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei257Substrate1
Active sitei291Phosphocysteine intermediatePROSITE-ProRule annotation1 Publication1
Binding sitei335Substrate1

GO - Molecular functioni

  • protein tyrosine phosphatase activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
ReactomeiR-HSA-9008059 Interleukin-37 signaling
SABIO-RKiP35236
SIGNORiP35236

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 7 (EC:3.1.3.48)
Alternative name(s):
Hematopoietic protein-tyrosine phosphatase
Short name:
HEPTP
Protein-tyrosine phosphatase LC-PTP
Gene namesi
Name:PTPN7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000143851.15
HGNCiHGNC:9659 PTPN7
MIMi176889 gene
neXtProtiNX_P35236

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi44S → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation. 1 Publication1
Mutagenesisi44S → D: Reduces binding of MAP kinase. 1 Publication1
Mutagenesisi66T → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation; when associated with A-93. 1 Publication1
Mutagenesisi93S → A: Prevents dissociation of bound MAP kinase and enhances their dephosphorylation; when associated with A-66. 1 Publication1
Mutagenesisi125Y → A: Strongly reduced catalytic activity. 1 Publication1
Mutagenesisi257D → A: Loss of catalytic activity. 1 Publication1
Mutagenesisi291C → S: Loss of catalytic activity. 1 Publication1
Mutagenesisi335Q → A: Reduced catalytic activity. 1 Publication1

Organism-specific databases

DisGeNETi5778
OpenTargetsiENSG00000143851
PharmGKBiPA34003

Chemistry databases

ChEMBLiCHEMBL2219

Polymorphism and mutation databases

DMDMi20141721

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000947611 – 360Tyrosine-protein phosphatase non-receptor type 7Add BLAST360

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei44PhosphoserineCombined sources2 Publications1
Modified residuei66PhosphothreonineCombined sources1 Publication1
Modified residuei93Phosphoserine1 Publication1
Modified residuei110PhosphoserineCombined sources1
Modified residuei143PhosphoserineCombined sources1
Modified residuei291Cysteine sulfenic acid (-SOH)By similarity1

Post-translational modificationi

Phosphorylated on serine residues in resting T-cells. Phosphorylation increases upon exposure to stimuli that increase intracellular cAMP levels. Phosphorylation leads to dissociation of bound MAP kinases.3 Publications
Oxidized at active site cysteine. Treatment with pervanadate (vanadate and H2O2) or with antigen enhanced oxidation of active site cysteine (By similarity).By similarity

Keywords - PTMi

Oxidation, Phosphoprotein

Proteomic databases

EPDiP35236
MaxQBiP35236
PaxDbiP35236
PeptideAtlasiP35236
PRIDEiP35236
ProteomicsDBi54996
54997 [P35236-2]

PTM databases

DEPODiP35236
iPTMnetiP35236
PhosphoSitePlusiP35236

Expressioni

Tissue specificityi

Expressed exclusively in thymus and spleen.2 Publications

Gene expression databases

BgeeiENSG00000143851 Expressed in 132 organ(s), highest expression level in blood
CleanExiHS_PTPN7
ExpressionAtlasiP35236 baseline and differential
GenevisibleiP35236 HS

Organism-specific databases

HPAiCAB009530
HPA019118

Interactioni

Subunit structurei

Monomer. Interacts with MAPK1, MAPK3 and several other MAP kinases.7 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi111743, 36 interactors
DIPiDIP-29118N
ELMiP35236
IntActiP35236, 10 interactors
MINTiP35236
STRINGi9606.ENSP00000309116

Chemistry databases

BindingDBiP35236

Structurei

Secondary structure

1360
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP35236
SMRiP35236
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35236

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini97 – 350Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST254

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni38 – 51Interaction with MAP kinasesAdd BLAST14
Regioni291 – 297Substrate binding7

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0789 Eukaryota
COG5599 LUCA
GeneTreeiENSGT00920000148980
HOGENOMiHOG000294188
HOVERGENiHBG001594
InParanoidiP35236
KOiK18019
OrthoDBiEOG091G0HLB
PhylomeDBiP35236
TreeFamiTF331016

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR029021 Prot-tyrosine_phosphatase-like
IPR000242 PTPase_domain
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR008356 Tyr_Pase_KIM-con
IPR000387 TYR_PHOSPHATASE_dom
PfamiView protein in Pfam
PF00102 Y_phosphatase, 1 hit
PRINTSiPR01778 KIMPTPASE
PR00700 PRTYPHPHTASE
SMARTiView protein in SMART
SM00194 PTPc, 1 hit
SM00404 PTPc_motif, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50055 TYR_PHOSPHATASE_PTP, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 11 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: P35236-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQAHGGRSR AQPLTLSLGA AMTQPPPEKT PAKKHVRLQE RRGSNVALML
60 70 80 90 100
DVRSLGAVEP ICSVNTPREV TLHFLRTAGH PLTRWALQRQ PPSPKQLEEE
110 120 130 140 150
FLKIPSNFVS PEDLDIPGHA SKDRYKTILP NPQSRVCLGR AQSQEDGDYI
160 170 180 190 200
NANYIRGYDG KEKVYIATQG PMPNTVSDFW EMVWQEEVSL IVMLTQLREG
210 220 230 240 250
KEKCVHYWPT EEETYGPFQI RIQDMKECPE YTVRQLTIQY QEERRSVKHI
260 270 280 290 300
LFSAWPDHQT PESAGPLLRL VAEVEESPET AAHPGPIVVH CSAGIGRTGC
310 320 330 340 350
FIATRIGCQQ LKARGEVDIL GIVCQLRLDR GGMIQTAEQY QFLHHTLALY
360
AGQLPEEPSP
Length:360
Mass (Da):40,529
Last modified:January 23, 2002 - v3
Checksum:i388A154CC55AC0EE
GO
Isoform 2 (identifier: P35236-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGASFWPIRQAREQQRRALSFRQTSWLSEPPLGPAPHLSM

Show »
Length:399
Mass (Da):45,002
Checksum:i16690FDF358E20C8
GO
Isoform 3 (identifier: P35236-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVGKAWPLTH...PLGPAPHLSM

Show »
Length:465
Mass (Da):52,284
Checksum:iAB2E025ECD392906
GO

Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KR55J3KR55_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
441Annotation score:
H7C4T8H7C4T8_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
122Annotation score:
H7C5I3H7C5I3_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
163Annotation score:
E7EUM0E7EUM0_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
154Annotation score:
C9IYI6C9IYI6_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
153Annotation score:
E9PE54E9PE54_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
140Annotation score:
C9JBA9C9JBA9_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
102Annotation score:
F8WF66F8WF66_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
116Annotation score:
C9JAW7C9JAW7_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
153Annotation score:
F8WF08F8WF08_HUMAN
Tyrosine-protein phosphatase non-re...
PTPN7
140Annotation score:
There is more potential isoformShow all

Sequence cautioni

The sequence AAA59531 differs from that shown. Reason: Frameshift at position 5.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti235 – 236QL → HV in AAA59531 (PubMed:1530918).Curated2
Sequence conflicti337A → D in BAA01946 (PubMed:1510684).Curated1
Isoform 3 (identifier: P35236-3)
Sequence conflicti37Q → R in BAG54453 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0269251M → MGASFWPIRQAREQQRRALS FRQTSWLSEPPLGPAPHLSM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0472751M → MVGKAWPLTHSQGTGPWAPE GHRREAADPWWQRQQAQEGR MQLGCAWVAARRGGGRKLAS WSLLSPQRQTDRQTDSWQEA AWGPQLLQQTSWLSEPPLGP APHLSM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D11327 mRNA Translation: BAA01946.1
M64322 mRNA Translation: AAA59531.1 Frameshift.
BT009848 mRNA Translation: AAP88850.1
AK127214 mRNA Translation: BAG54453.1
AL592300 Genomic DNA No translation available.
BC001746 mRNA Translation: AAH01746.2
CCDSiCCDS1422.1 [P35236-2]
CCDS1423.2 [P35236-3]
PIRiJH0692
RefSeqiNP_002823.3, NM_002832.3 [P35236-3]
NP_542155.1, NM_080588.2 [P35236-2]
UniGeneiHs.402773

Genome annotation databases

EnsembliENST00000309017; ENSP00000309116; ENSG00000143851 [P35236-3]
ENST00000367279; ENSP00000356248; ENSG00000143851 [P35236-2]
ENST00000495688; ENSP00000420506; ENSG00000143851 [P35236-1]
GeneIDi5778
KEGGihsa:5778
UCSCiuc001gxl.2 human [P35236-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D11327 mRNA Translation: BAA01946.1
M64322 mRNA Translation: AAA59531.1 Frameshift.
BT009848 mRNA Translation: AAP88850.1
AK127214 mRNA Translation: BAG54453.1
AL592300 Genomic DNA No translation available.
BC001746 mRNA Translation: AAH01746.2
CCDSiCCDS1422.1 [P35236-2]
CCDS1423.2 [P35236-3]
PIRiJH0692
RefSeqiNP_002823.3, NM_002832.3 [P35236-3]
NP_542155.1, NM_080588.2 [P35236-2]
UniGeneiHs.402773

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZC0X-ray1.85A65-360[»]
2A3KX-ray2.55A65-358[»]
2GP0X-ray2.05A65-360[»]
2GPHX-ray1.90B37-52[»]
2HVLX-ray2.40A65-360[»]
2QDCX-ray2.00A65-360[»]
2QDMX-ray2.05A65-360[»]
2QDPX-ray2.72A65-360[»]
3D42X-ray2.46A65-360[»]
3D44X-ray1.90A65-360[»]
3O4SX-ray1.90A65-360[»]
3O4TX-ray2.60A65-360[»]
3O4UX-ray2.25A65-360[»]
ProteinModelPortaliP35236
SMRiP35236
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111743, 36 interactors
DIPiDIP-29118N
ELMiP35236
IntActiP35236, 10 interactors
MINTiP35236
STRINGi9606.ENSP00000309116

Chemistry databases

BindingDBiP35236
ChEMBLiCHEMBL2219

PTM databases

DEPODiP35236
iPTMnetiP35236
PhosphoSitePlusiP35236

Polymorphism and mutation databases

DMDMi20141721

Proteomic databases

EPDiP35236
MaxQBiP35236
PaxDbiP35236
PeptideAtlasiP35236
PRIDEiP35236
ProteomicsDBi54996
54997 [P35236-2]

Protocols and materials databases

DNASUi5778
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309017; ENSP00000309116; ENSG00000143851 [P35236-3]
ENST00000367279; ENSP00000356248; ENSG00000143851 [P35236-2]
ENST00000495688; ENSP00000420506; ENSG00000143851 [P35236-1]
GeneIDi5778
KEGGihsa:5778
UCSCiuc001gxl.2 human [P35236-1]

Organism-specific databases

CTDi5778
DisGeNETi5778
EuPathDBiHostDB:ENSG00000143851.15
GeneCardsiPTPN7
H-InvDBiHIX0001472
HGNCiHGNC:9659 PTPN7
HPAiCAB009530
HPA019118
MIMi176889 gene
neXtProtiNX_P35236
OpenTargetsiENSG00000143851
PharmGKBiPA34003
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0789 Eukaryota
COG5599 LUCA
GeneTreeiENSGT00920000148980
HOGENOMiHOG000294188
HOVERGENiHBG001594
InParanoidiP35236
KOiK18019
OrthoDBiEOG091G0HLB
PhylomeDBiP35236
TreeFamiTF331016

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
ReactomeiR-HSA-9008059 Interleukin-37 signaling
SABIO-RKiP35236
SIGNORiP35236

Miscellaneous databases

ChiTaRSiPTPN7 human
EvolutionaryTraceiP35236
GeneWikiiPTPN7
GenomeRNAii5778
PROiPR:P35236
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143851 Expressed in 132 organ(s), highest expression level in blood
CleanExiHS_PTPN7
ExpressionAtlasiP35236 baseline and differential
GenevisibleiP35236 HS

Family and domain databases

Gene3Di3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR029021 Prot-tyrosine_phosphatase-like
IPR000242 PTPase_domain
IPR016130 Tyr_Pase_AS
IPR003595 Tyr_Pase_cat
IPR008356 Tyr_Pase_KIM-con
IPR000387 TYR_PHOSPHATASE_dom
PfamiView protein in Pfam
PF00102 Y_phosphatase, 1 hit
PRINTSiPR01778 KIMPTPASE
PR00700 PRTYPHPHTASE
SMARTiView protein in SMART
SM00194 PTPc, 1 hit
SM00404 PTPc_motif, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
PROSITEiView protein in PROSITE
PS00383 TYR_PHOSPHATASE_1, 1 hit
PS50056 TYR_PHOSPHATASE_2, 1 hit
PS50055 TYR_PHOSPHATASE_PTP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPTN7_HUMAN
AccessioniPrimary (citable) accession number: P35236
Secondary accession number(s): B3KXE1
, Q53XK4, Q5SXQ0, Q5SXQ1, Q9BV05
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2002
Last modified: September 12, 2018
This is version 175 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again