UniProtKB - P35080 (PROF2_HUMAN)
Profilin-2
PFN2
Functioni
GO - Molecular functioni
- actin binding Source: GO_Central
- actin monomer binding Source: UniProtKB
- ATPase activity Source: GO_Central
- phosphatidylinositol-4,5-bisphosphate binding Source: UniProtKB
GO - Biological processi
- actin cytoskeleton organization Source: InterPro
- negative regulation of actin filament polymerization Source: UniProtKB
- negative regulation of epithelial cell migration Source: UniProtKB
- negative regulation of ruffle assembly Source: UniProtKB
- positive regulation of actin filament bundle assembly Source: UniProtKB
- positive regulation of actin filament polymerization Source: UniProtKB
- positive regulation of ATPase activity Source: UniProtKB
- positive regulation of peptidyl-serine phosphorylation Source: UniProtKB
- positive regulation of stress fiber assembly Source: UniProtKB
- protein stabilization Source: UniProtKB
- regulation of actin filament polymerization Source: GO_Central
Keywordsi
Molecular function | Actin-binding |
Enzyme and pathway databases
PathwayCommonsi | P35080 |
Reactomei | R-HSA-376176, Signaling by ROBO receptors R-HSA-5663220, RHO GTPases Activate Formins |
Names & Taxonomyi
Protein namesi | Recommended name: Profilin-2Alternative name(s): Profilin II |
Gene namesi | Name:PFN2 |
Organismi | Homo sapiens (Human) |
Taxonomic identifieri | 9606 [NCBI] |
Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Proteomesi |
|
Organism-specific databases
HGNCi | HGNC:8882, PFN2 |
MIMi | 176590, gene |
neXtProti | NX_P35080 |
VEuPathDBi | HostDB:ENSG00000070087.13 |
Subcellular locationi
Cytoskeleton
Cytoskeleton
- cytoskeleton Source: UniProtKB-SubCell
Extracellular region or secreted
- extracellular exosome Source: UniProtKB
Other locations
- cytoplasm Source: GO_Central
Keywords - Cellular componenti
Cytoplasm, CytoskeletonPathology & Biotechi
Organism-specific databases
DisGeNETi | 5217 |
OpenTargetsi | ENSG00000070087 |
PharmGKBi | PA33220 |
Miscellaneous databases
Pharosi | P35080, Tbio |
Chemistry databases
DrugBanki | DB02580, Pentaglyme DB02078, Triglyme |
Genetic variation databases
BioMutai | PFN2 |
DMDMi | 20178322 |
PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Initiator methioninei | RemovedCombined sources | |||
ChainiPRO_0000199575 | 2 – 140 | Profilin-2Add BLAST | 139 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Modified residuei | 2 | N-acetylalanineCombined sources | 1 |
Keywords - PTMi
AcetylationProteomic databases
EPDi | P35080 |
jPOSTi | P35080 |
MassIVEi | P35080 |
MaxQBi | P35080 |
PaxDbi | P35080 |
PeptideAtlasi | P35080 |
PRIDEi | P35080 |
ProteomicsDBi | 54978 [P35080-1] 54979 [P35080-2] |
2D gel databases
REPRODUCTION-2DPAGEi | P35080 |
PTM databases
iPTMneti | P35080 |
MetOSitei | P35080 |
PhosphoSitePlusi | P35080 |
SwissPalmi | P35080 |
Expressioni
Tissue specificityi
Gene expression databases
Bgeei | ENSG00000070087, Expressed in forebrain and 250 other tissues |
ExpressionAtlasi | P35080, baseline and differential |
Genevisiblei | P35080, HS |
Organism-specific databases
HPAi | ENSG00000070087, Tissue enhanced (brain) |
Interactioni
Subunit structurei
Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (PubMed:7758455).
Interacts with PFN2 (By similarity).
By similarity1 PublicationBinary interactionsi
Hide detailsP35080
With | #Exp. | IntAct |
---|---|---|
GOLGB1 [Q14789] | 2 | EBI-473138,EBI-709973 |
HTT [P42858] | 7 | EBI-473138,EBI-466029 |
Wasl [O08816] from Rattus norvegicus. | 3 | EBI-473138,EBI-6142604 |
GO - Molecular functioni
- actin binding Source: GO_Central
- actin monomer binding Source: UniProtKB
Protein-protein interaction databases
BioGRIDi | 111238, 65 interactors |
CORUMi | P35080 |
IntActi | P35080, 50 interactors |
MINTi | P35080 |
STRINGi | 9606.ENSP00000239940 |
Miscellaneous databases
RNActi | P35080, protein |
Structurei
Secondary structure
3D structure databases
BMRBi | P35080 |
SMRi | P35080 |
ModBasei | Search... |
PDBe-KBi | Search... |
Miscellaneous databases
EvolutionaryTracei | P35080 |
Family & Domainsi
Sequence similaritiesi
Phylogenomic databases
eggNOGi | KOG1755, Eukaryota |
GeneTreei | ENSGT00940000153664 |
InParanoidi | P35080 |
OMAi | KAPASHC |
OrthoDBi | 1428600at2759 |
PhylomeDBi | P35080 |
TreeFami | TF331744 |
Family and domain databases
CDDi | cd00148, PROF, 1 hit |
InterProi | View protein in InterPro IPR005455, PFN IPR029891, PFN2 IPR036140, PFN_sf IPR005454, Profilin1/2/3_vertebrate IPR027310, Profilin_CS |
PANTHERi | PTHR13936:SF15, PTHR13936:SF15, 1 hit |
Pfami | View protein in Pfam PF00235, Profilin, 1 hit |
PRINTSi | PR00392, PROFILIN PR01639, PROFILINMAML |
SMARTi | View protein in SMART SM00392, PROF, 1 hit |
SUPFAMi | SSF55770, SSF55770, 1 hit |
PROSITEi | View protein in PROSITE PS00414, PROFILIN, 1 hit |
s (2+)i Sequence
Sequence statusi: Complete.
: The displayed sequence is further processed into a mature form. Sequence processingi
This entry describes 2 produced by isoformsialternative splicing. AlignAdd to basketThis entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All
This isoform has been chosen as the sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. canonicali
10 20 30 40 50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM
60 70 80 90 100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN
110 120 130 140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
The sequence of this isoform differs from the canonical sequence as follows:
109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV
Computationally mapped potential isoform sequencesi
There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basketG5E9Q6 | G5E9Q6_HUMAN | Profilin | PFN2 hCG_21343 | 188 | Annotation score: | ||
C9J5V8 | C9J5V8_HUMAN | Profilin II | PFN2 | 45 | Annotation score: | ||
F2Z3G0 | F2Z3G0_HUMAN | Profilin II | PFN2 | 55 | Annotation score: | ||
C9J2N0 | C9J2N0_HUMAN | Profilin | PFN2 | 125 | Annotation score: | ||
C9J712 | C9J712_HUMAN | Profilin | PFN2 | 91 | Annotation score: | ||
C9JQ45 | C9JQ45_HUMAN | Profilin | PFN2 | 110 | Annotation score: | ||
C9J0J7 | C9J0J7_HUMAN | Profilin | PFN2 | 91 | Annotation score: |
Experimental Info
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Sequence conflicti | 65 | T → A in AAH18049 (PubMed:15489334).Curated | 1 |
Alternative sequence
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Alternative sequenceiVSP_005217 | 109 – 140 | VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. 3 PublicationsAdd BLAST | 32 |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | L10678 mRNA Translation: AAA03022.1 AF228738 mRNA Translation: AAG24949.1 AK311780 mRNA Translation: BAG34723.1 AK311782 mRNA Translation: BAG34725.1 CH471052 Genomic DNA Translation: EAW78850.1 BC002964 mRNA No translation available. CH471052 Genomic DNA Translation: EAW78852.1 BC018049 mRNA Translation: AAH18049.1 BC043646 mRNA Translation: AAH43646.1 BC095444 mRNA Translation: AAH95444.1 |
CCDSi | CCDS3148.1 [P35080-1] CCDS46934.1 [P35080-2] |
PIRi | S36804 |
RefSeqi | NP_002619.1, NM_002628.4 [P35080-2] NP_444252.1, NM_053024.3 [P35080-1] |
Genome annotation databases
Ensembli | ENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1] ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2] |
GeneIDi | 5217 |
KEGGi | hsa:5217 |
UCSCi | uc003ext.3, human [P35080-1] |
Keywords - Coding sequence diversityi
Alternative splicingSimilar proteinsi
Cross-referencesi
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | L10678 mRNA Translation: AAA03022.1 AF228738 mRNA Translation: AAG24949.1 AK311780 mRNA Translation: BAG34723.1 AK311782 mRNA Translation: BAG34725.1 CH471052 Genomic DNA Translation: EAW78850.1 BC002964 mRNA No translation available. CH471052 Genomic DNA Translation: EAW78852.1 BC018049 mRNA Translation: AAH18049.1 BC043646 mRNA Translation: AAH43646.1 BC095444 mRNA Translation: AAH95444.1 |
CCDSi | CCDS3148.1 [P35080-1] CCDS46934.1 [P35080-2] |
PIRi | S36804 |
RefSeqi | NP_002619.1, NM_002628.4 [P35080-2] NP_444252.1, NM_053024.3 [P35080-1] |
3D structure databases
Select the link destinations: PDBei RCSB PDBi PDBji Links Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
1D1J | X-ray | 2.20 | A/B/C/D | 2-138 | [»] | |
BMRBi | P35080 | |||||
SMRi | P35080 | |||||
ModBasei | Search... | |||||
PDBe-KBi | Search... |
Protein-protein interaction databases
BioGRIDi | 111238, 65 interactors |
CORUMi | P35080 |
IntActi | P35080, 50 interactors |
MINTi | P35080 |
STRINGi | 9606.ENSP00000239940 |
Chemistry databases
DrugBanki | DB02580, Pentaglyme DB02078, Triglyme |
PTM databases
iPTMneti | P35080 |
MetOSitei | P35080 |
PhosphoSitePlusi | P35080 |
SwissPalmi | P35080 |
Genetic variation databases
BioMutai | PFN2 |
DMDMi | 20178322 |
2D gel databases
REPRODUCTION-2DPAGEi | P35080 |
Proteomic databases
EPDi | P35080 |
jPOSTi | P35080 |
MassIVEi | P35080 |
MaxQBi | P35080 |
PaxDbi | P35080 |
PeptideAtlasi | P35080 |
PRIDEi | P35080 |
ProteomicsDBi | 54978 [P35080-1] 54979 [P35080-2] |
Protocols and materials databases
Antibodypediai | 33583, 257 antibodies |
DNASUi | 5217 |
Genome annotation databases
Ensembli | ENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1] ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2] |
GeneIDi | 5217 |
KEGGi | hsa:5217 |
UCSCi | uc003ext.3, human [P35080-1] |
Organism-specific databases
CTDi | 5217 |
DisGeNETi | 5217 |
GeneCardsi | PFN2 |
HGNCi | HGNC:8882, PFN2 |
HPAi | ENSG00000070087, Tissue enhanced (brain) |
MIMi | 176590, gene |
neXtProti | NX_P35080 |
OpenTargetsi | ENSG00000070087 |
PharmGKBi | PA33220 |
VEuPathDBi | HostDB:ENSG00000070087.13 |
GenAtlasi | Search... |
Phylogenomic databases
eggNOGi | KOG1755, Eukaryota |
GeneTreei | ENSGT00940000153664 |
InParanoidi | P35080 |
OMAi | KAPASHC |
OrthoDBi | 1428600at2759 |
PhylomeDBi | P35080 |
TreeFami | TF331744 |
Enzyme and pathway databases
PathwayCommonsi | P35080 |
Reactomei | R-HSA-376176, Signaling by ROBO receptors R-HSA-5663220, RHO GTPases Activate Formins |
Miscellaneous databases
BioGRID-ORCSi | 5217, 1 hit in 874 CRISPR screens |
ChiTaRSi | PFN2, human |
EvolutionaryTracei | P35080 |
GeneWikii | PFN2 |
GenomeRNAii | 5217 |
Pharosi | P35080, Tbio |
PROi | PR:P35080 |
RNActi | P35080, protein |
SOURCEi | Search... |
Gene expression databases
Bgeei | ENSG00000070087, Expressed in forebrain and 250 other tissues |
ExpressionAtlasi | P35080, baseline and differential |
Genevisiblei | P35080, HS |
Family and domain databases
CDDi | cd00148, PROF, 1 hit |
InterProi | View protein in InterPro IPR005455, PFN IPR029891, PFN2 IPR036140, PFN_sf IPR005454, Profilin1/2/3_vertebrate IPR027310, Profilin_CS |
PANTHERi | PTHR13936:SF15, PTHR13936:SF15, 1 hit |
Pfami | View protein in Pfam PF00235, Profilin, 1 hit |
PRINTSi | PR00392, PROFILIN PR01639, PROFILINMAML |
SMARTi | View protein in SMART SM00392, PROF, 1 hit |
SUPFAMi | SSF55770, SSF55770, 1 hit |
PROSITEi | View protein in PROSITE PS00414, PROFILIN, 1 hit |
ProtoNeti | Search... |
MobiDBi | Search... |
Entry informationi
Entry namei | PROF2_HUMAN | |
Accessioni | P35080Primary (citable) accession number: P35080 Secondary accession number(s): B2R4C8 Q9HBK2 | |
Entry historyi | Integrated into UniProtKB/Swiss-Prot: | February 1, 1994 |
Last sequence update: | January 23, 2007 | |
Last modified: | February 10, 2021 | |
This is version 204 of the entry and version 3 of the sequence. See complete history. | ||
Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program | |
Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Miscellaneousi
Keywords - Technical termi
3D-structure, Direct protein sequencing, Reference proteomeDocuments
- MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references - SIMILARITY comments
Index of protein domains and families - Human chromosome 3
Human chromosome 3: entries, gene names and cross-references to MIM