PFN2

Functionⁱ

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

GO - Molecular functionⁱ

actin monomer binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 7758455
ATPase activity
Source: GO_Central
Inferred from direct assayⁱ
- 7758455
phosphatidylinositol-4,5-bisphosphate binding
Source: UniProtKB
Inferred from direct assayⁱ
- 7758455

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

actin cytoskeleton organization Source: InterPro
modification of postsynaptic actin cytoskeleton Source: Ensembl
negative regulation of actin filament polymerization
Source: UniProtKB
Inferred from direct assayⁱ
- 7758455
negative regulation of epithelial cell migration
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23153535
negative regulation of ruffle assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23153535
positive regulation of actin filament bundle assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23153535
positive regulation of actin filament polymerization
Source: UniProtKB
Inferred from genetic interactionⁱ
- 23153535
positive regulation of ATPase activity
Source: UniProtKB
Inferred from direct assayⁱ
- 7758455
positive regulation of peptidyl-serine phosphorylation
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23153535
positive regulation of stress fiber assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23153535
protein stabilization
Source: UniProtKB
Inferred from direct assayⁱ
- 18573880
regulation of synaptic vesicle exocytosis Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Actin-binding

Molecular function

Actin-binding

Enzyme and pathway databases

Reactomeⁱ	R-HSA-376176 Signaling by ROBO receptors R-HSA-5663220 RHO GTPases Activate Formins

Reactomeⁱ

R-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Profilin-2 Alternative name(s): Profilin II
Gene namesⁱ	Name:PFN2
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 3

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000070087.13
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:8882 PFN2
MIMⁱ	176590 gene
neXtProtⁱ	NX_P35080

Keywords - Cellular componentⁱ

Cytoplasm, Cytoskeleton

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	5217
Open Targets More...OpenTargetsⁱ	ENSG00000070087
PharmGKBⁱ	PA33220

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB02580 1-(2-Methoxy-Ethoxy)-2-{2-[2-(2-Methoxy-Ethoxy]-Ethoxy}-Ethane DB02078 1-Methoxy-2-[2-(2-Methoxy-Ethoxy]-Ethane

DrugBankⁱ

DB02580 1-(2-Methoxy-Ethoxy)-2-{2-[2-(2-Methoxy-Ethoxy]-Ethoxy}-Ethane
DB02078 1-Methoxy-2-[2-(2-Methoxy-Ethoxy]-Ethane

Polymorphism and mutation databases

BioMutaⁱ	PFN2
DMDMⁱ	20178322

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources
ChainⁱPRO_0000199575	2 – 140	Profilin-2Add BLAST		139

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	2	N-acetylalanineCombined sources		1

Keywords - PTMⁱ

Acetylation

Proteomic databases

EPDⁱ	P35080
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P35080
PaxDbⁱ	P35080
PeptideAtlas More...PeptideAtlasⁱ	P35080
PRIDEⁱ	P35080
ProteomicsDBⁱ	54978 54979 [P35080-2]

2D gel databases

REPRODUCTION-2DPAGE More...REPRODUCTION-2DPAGEⁱ	P35080

REPRODUCTION-2DPAGEⁱ

P35080

PTM databases

iPTMnetⁱ	P35080
PhosphoSitePlusⁱ	P35080

Expressionⁱ

Tissue specificityⁱ

Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

Gene expression databases

Bgeeⁱ	ENSG00000070087 Expressed in 238 organ(s), highest expression level in forebrain
CleanExⁱ	HS_PFN2
ExpressionAtlasⁱ	P35080 baseline and differential
Genevisibleⁱ	P35080 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB037073 HPA035611

HPAⁱ

CAB037073
HPA035611

Interactionⁱ

Subunit structureⁱ

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (PubMed:7758455). Interacts with PFN2 (By similarity).By similarity1 Publication

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
GOLGB1	Q14789	2	EBI-473138,EBI-709973
HTT	P42858	4	EBI-473138,EBI-466029
Wasl	O08816	3	EBI-473138,EBI-6142604	From Rattus norvegicus.

GO - Molecular functionⁱ

actin monomer binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 7758455

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	111238, 51 interactors
CORUMⁱ	P35080
IntActⁱ	P35080, 36 interactors
Molecular INTeraction database More...MINTⁱ	P35080
STRINGⁱ	9606.ENSP00000239940

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	5 – 11	Combined sources	7
Beta strandⁱ	17 – 24	Combined sources	8
Beta strandⁱ	26 – 28	Combined sources	3
Beta strandⁱ	30 – 34	Combined sources	5
Helixⁱ	40 – 42	Combined sources	3
Helixⁱ	45 – 52	Combined sources	8
Helixⁱ	58 – 62	Combined sources	5
Beta strandⁱ	64 – 66	Combined sources	3
Beta strandⁱ	69 – 80	Combined sources	12
Beta strandⁱ	85 – 90	Combined sources	6
Beta strandⁱ	93 – 95	Combined sources	3
Beta strandⁱ	100 – 105	Combined sources	6
Beta strandⁱ	107 – 115	Combined sources	9
Helixⁱ	121 – 137	Combined sources	17

Show more details

3D structure databases

ProteinModelPortalⁱ	P35080
SMRⁱ	P35080
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P35080

EvolutionaryTraceⁱ

P35080

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the profilin family.Curated

Phylogenomic databases

eggNOGⁱ	KOG1755 Eukaryota ENOG41126PD LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000010143
HOGENOMⁱ	HOG000171592
HOVERGENⁱ	HBG053683
InParanoidⁱ	P35080
KEGG Orthology (KO) More...KOⁱ	K05759
OMAⁱ	FFHMCSV
PhylomeDBⁱ	P35080
TreeFamⁱ	TF331744

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00148 PROF, 1 hit
InterProⁱ	View protein in InterPro IPR005455 PFN IPR029891 PFN2 IPR036140 PFN_sf IPR005454 Profilin1/2/3_vertebrate IPR027310 Profilin_CS
PANTHERⁱ	PTHR13936:SF15 PTHR13936:SF15, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00235 Profilin, 1 hit
PRINTSⁱ	PR00392 PROFILIN PR01639 PROFILINMAML
SMARTⁱ	View protein in SMART SM00392 PROF, 1 hit
SUPFAMⁱ	SSF55770 SSF55770, 1 hit
PROSITEⁱ	View protein in PROSITE PS00414 PROFILIN, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show all Align All

Isoform IIa (identifier: P35080-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM 
        60         70         80         90        100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN 
       110        120        130        140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF

Length:140

Mass (Da):15,046

Last modified:January 23, 2007 - v3

Checksum:ⁱF43884E1427C9A99

GO

Isoform IIb (identifier: P35080-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV

« Hide

        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM 
        60         70         80         90        100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN 
       110        120        130        140
VAVGRAGRAL VIVMGKEGVH GGTLNKKAYE LALYLRRSDV

Show »

Length:140

Mass (Da):15,088

Checksum:ⁱB4CAC8A1ED8C658B

GO

Computationally mapped potential isoform sequencesⁱ

There are 7 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

G5E9Q6	G5E9Q6_HUMAN	Profilin Profilin	PFN2 hCG_21343	188	Annotation score:
C9JQ45	C9JQ45_HUMAN	Profilin Profilin	PFN2	110	Annotation score:
C9J2N0	C9J2N0_HUMAN	Profilin Profilin	PFN2	125	Annotation score:
C9J712	C9J712_HUMAN	Profilin Profilin	PFN2	91	Annotation score:
C9J0J7	C9J0J7_HUMAN	Profilin Profilin	PFN2	91	Annotation score:
F2Z3G0	F2Z3G0_HUMAN	Profilin-2 Profilin-2	PFN2	55	Annotation score:
C9J5V8	C9J5V8_HUMAN	Profilin-2 Profilin-2	PFN2	45	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	65	T → A in AAH18049 (PubMed:15489334).Curated		1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_005217	109 – 140	VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. 3 PublicationsAdd BLAST		32

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L10678 mRNA Translation: AAA03022.1 AF228738 mRNA Translation: AAG24949.1 AK311780 mRNA Translation: BAG34723.1 AK311782 mRNA Translation: BAG34725.1 CH471052 Genomic DNA Translation: EAW78850.1 BC002964 mRNA No translation available. CH471052 Genomic DNA Translation: EAW78852.1 BC018049 mRNA Translation: AAH18049.1 BC043646 mRNA Translation: AAH43646.1 BC095444 mRNA Translation: AAH95444.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS3148.1 [P35080-1] CCDS46934.1 [P35080-2]
PIRⁱ	S36804
NCBI Reference Sequences More...RefSeqⁱ	NP_002619.1, NM_002628.4 [P35080-2] NP_444252.1, NM_053024.3 [P35080-1]
UniGeneⁱ	Hs.91747

Genome annotation databases

Ensemblⁱ	ENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1] ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2]
GeneIDⁱ	5217
KEGGⁱ	hsa:5217
UCSC genome browser More...UCSCⁱ	uc003ext.3 human [P35080-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P35080	Profilin-2		MACFA		140	UniRef100_P35080
Profilin-2		PONAB		140
Profilin		HUMAN		91
Profilin		PANTR		91
Profilin		SAIBB		91
+25
P35080-2	Profilin		CALJA		140	UniRef100_P35080-2
Profilin (Fragment)		HUMAN		334
Profilin		MACMU		140
Profilin		PANTR		140
Profilin		PONAB		140
+3

Protein	Similar proteins		Species	Score	Length	Source
P35080	Profilin-2		MACFA		140	UniRef90_P35080
Profilin-2		PONAB		140
Profilin		HUMAN		91
Profilin		PANTR		91
Profilin		SAIBB		91
+26
P35080-2	Profilin		CALJA		140	UniRef90_P35080-2
Profilin (Fragment)		HUMAN		334
Profilin		MACMU		140
Profilin		PANTR		140
Profilin		PONAB		140
+4

Protein	Similar proteins		Species	Score	Length	Source
P35080	Profilin-2		MACFA		140	UniRef50_P35080
Profilin-2		PONAB		140
Profilin		HUMAN		91
Profilin		PANTR		91
Profilin		SAIBB		91
+26
P35080-2	Profilin		CALJA		140	UniRef50_P35080-2
Profilin (Fragment)		HUMAN		334
Profilin		MACMU		140
Profilin		PANTR		140
Profilin		PONAB		140
+10

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	L10678 mRNA Translation: AAA03022.1 AF228738 mRNA Translation: AAG24949.1 AK311780 mRNA Translation: BAG34723.1 AK311782 mRNA Translation: BAG34725.1 CH471052 Genomic DNA Translation: EAW78850.1 BC002964 mRNA No translation available. CH471052 Genomic DNA Translation: EAW78852.1 BC018049 mRNA Translation: AAH18049.1 BC043646 mRNA Translation: AAH43646.1 BC095444 mRNA Translation: AAH95444.1
CCDSⁱ	CCDS3148.1 [P35080-1] CCDS46934.1 [P35080-2]
PIRⁱ	S36804
RefSeqⁱ	NP_002619.1, NM_002628.4 [P35080-2] NP_444252.1, NM_053024.3 [P35080-1]
UniGeneⁱ	Hs.91747

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1D1J	X-ray	2.20	A/B/C/D	2-138	[»]
ProteinModelPortalⁱ	P35080
SMRⁱ	P35080
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	111238, 51 interactors
CORUMⁱ	P35080
IntActⁱ	P35080, 36 interactors
MINTⁱ	P35080
STRINGⁱ	9606.ENSP00000239940

Chemistry databases

DrugBankⁱ	DB02580 1-(2-Methoxy-Ethoxy)-2-{2-[2-(2-Methoxy-Ethoxy]-Ethoxy}-Ethane DB02078 1-Methoxy-2-[2-(2-Methoxy-Ethoxy]-Ethane

DrugBankⁱ

DB02580 1-(2-Methoxy-Ethoxy)-2-{2-[2-(2-Methoxy-Ethoxy]-Ethoxy}-Ethane
DB02078 1-Methoxy-2-[2-(2-Methoxy-Ethoxy]-Ethane

PTM databases

iPTMnetⁱ	P35080
PhosphoSitePlusⁱ	P35080

Polymorphism and mutation databases

BioMutaⁱ	PFN2
DMDMⁱ	20178322

2D gel databases

REPRODUCTION-2DPAGEⁱ	P35080

REPRODUCTION-2DPAGEⁱ

P35080

Proteomic databases

EPDⁱ	P35080
MaxQBⁱ	P35080
PaxDbⁱ	P35080
PeptideAtlasⁱ	P35080
PRIDEⁱ	P35080
ProteomicsDBⁱ	54978 54979 [P35080-2]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	5217
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1] ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2]
GeneIDⁱ	5217
KEGGⁱ	hsa:5217
UCSCⁱ	uc003ext.3 human [P35080-1]

Organism-specific databases

CTDⁱ	5217
DisGeNETⁱ	5217
EuPathDBⁱ	HostDB:ENSG00000070087.13
GeneCardsⁱ	PFN2
HGNCⁱ	HGNC:8882 PFN2
HPAⁱ	CAB037073 HPA035611
MIMⁱ	176590 gene
neXtProtⁱ	NX_P35080
OpenTargetsⁱ	ENSG00000070087
PharmGKBⁱ	PA33220
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1755 Eukaryota ENOG41126PD LUCA
GeneTreeⁱ	ENSGT00390000010143
HOGENOMⁱ	HOG000171592
HOVERGENⁱ	HBG053683
InParanoidⁱ	P35080
KOⁱ	K05759
OMAⁱ	FFHMCSV
PhylomeDBⁱ	P35080
TreeFamⁱ	TF331744

Enzyme and pathway databases

Reactomeⁱ	R-HSA-376176 Signaling by ROBO receptors R-HSA-5663220 RHO GTPases Activate Formins

Reactomeⁱ

R-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRSⁱ	PFN2 human
EvolutionaryTraceⁱ	P35080
GeneWikiⁱ	PFN2
GenomeRNAiⁱ	5217
Protein Ontology More...PROⁱ	PR:P35080
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000070087 Expressed in 238 organ(s), highest expression level in forebrain
CleanExⁱ	HS_PFN2
ExpressionAtlasⁱ	P35080 baseline and differential
Genevisibleⁱ	P35080 HS

Family and domain databases

CDDⁱ	cd00148 PROF, 1 hit
InterProⁱ	View protein in InterPro IPR005455 PFN IPR029891 PFN2 IPR036140 PFN_sf IPR005454 Profilin1/2/3_vertebrate IPR027310 Profilin_CS
PANTHERⁱ	PTHR13936:SF15 PTHR13936:SF15, 1 hit
Pfamⁱ	View protein in Pfam PF00235 Profilin, 1 hit
PRINTSⁱ	PR00392 PROFILIN PR01639 PROFILINMAML
SMARTⁱ	View protein in SMART SM00392 PROF, 1 hit
SUPFAMⁱ	SSF55770 SSF55770, 1 hit
PROSITEⁱ	View protein in PROSITE PS00414 PROFILIN, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PROF2_HUMAN
Accessionⁱ	P35080Primary (citable) accession number: P35080 Secondary accession number(s): B2R4C8 , D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1994
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 188 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human chromosome 3
Human chromosome 3: entries, gene names and cross-references to MIM
SIMILARITY comments
Index of protein domains and families
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P35080 (PROF2_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Profilin-2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Cytoskeleton

Cytoskeleton

Extracellular region or secreted

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

2D gel databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

2D gel databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ