Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Profilin-2

Gene

PFN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

GO - Molecular functioni

  • actin monomer binding Source: UniProtKB
  • ATPase activity Source: GO_Central
  • phosphatidylinositol-4,5-bisphosphate binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

ReactomeiR-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins

Names & Taxonomyi

Protein namesi
Recommended name:
Profilin-2
Alternative name(s):
Profilin II
Gene namesi
Name:PFN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000070087.13
HGNCiHGNC:8882 PFN2
MIMi176590 gene
neXtProtiNX_P35080

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi5217
OpenTargetsiENSG00000070087
PharmGKBiPA33220

Chemistry databases

DrugBankiDB02580 1-(2-Methoxy-Ethoxy)-2-{2-[2-(2-Methoxy-Ethoxy]-Ethoxy}-Ethane
DB02078 1-Methoxy-2-[2-(2-Methoxy-Ethoxy]-Ethane

Polymorphism and mutation databases

BioMutaiPFN2
DMDMi20178322

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001995752 – 140Profilin-2Add BLAST139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP35080
MaxQBiP35080
PaxDbiP35080
PeptideAtlasiP35080
PRIDEiP35080
ProteomicsDBi54978
54979 [P35080-2]

2D gel databases

REPRODUCTION-2DPAGEiP35080

PTM databases

iPTMnetiP35080
PhosphoSitePlusiP35080

Expressioni

Tissue specificityi

Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

Gene expression databases

BgeeiENSG00000070087 Expressed in 238 organ(s), highest expression level in forebrain
CleanExiHS_PFN2
ExpressionAtlasiP35080 baseline and differential
GenevisibleiP35080 HS

Organism-specific databases

HPAiCAB037073
HPA035611

Interactioni

Subunit structurei

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (PubMed:7758455). Interacts with PFN2 (By similarity).By similarity1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi111238, 51 interactors
CORUMiP35080
IntActiP35080, 36 interactors
MINTiP35080
STRINGi9606.ENSP00000239940

Structurei

Secondary structure

1140
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP35080
SMRiP35080
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35080

Family & Domainsi

Sequence similaritiesi

Belongs to the profilin family.Curated

Phylogenomic databases

eggNOGiKOG1755 Eukaryota
ENOG41126PD LUCA
GeneTreeiENSGT00390000010143
HOGENOMiHOG000171592
HOVERGENiHBG053683
InParanoidiP35080
KOiK05759
OMAiFFHMCSV
PhylomeDBiP35080
TreeFamiTF331744

Family and domain databases

CDDicd00148 PROF, 1 hit
InterProiView protein in InterPro
IPR005455 PFN
IPR029891 PFN2
IPR036140 PFN_sf
IPR005454 Profilin1/2/3_vertebrate
IPR027310 Profilin_CS
PANTHERiPTHR13936:SF15 PTHR13936:SF15, 1 hit
PfamiView protein in Pfam
PF00235 Profilin, 1 hit
PRINTSiPR00392 PROFILIN
PR01639 PROFILINMAML
SMARTiView protein in SMART
SM00392 PROF, 1 hit
SUPFAMiSSF55770 SSF55770, 1 hit
PROSITEiView protein in PROSITE
PS00414 PROFILIN, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform IIa (identifier: P35080-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM
60 70 80 90 100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN
110 120 130 140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
Length:140
Mass (Da):15,046
Last modified:January 23, 2007 - v3
Checksum:iF43884E1427C9A99
GO
Isoform IIb (identifier: P35080-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV

Show »
Length:140
Mass (Da):15,088
Checksum:iB4CAC8A1ED8C658B
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E9Q6G5E9Q6_HUMAN
Profilin
PFN2 hCG_21343
188Annotation score:
C9JQ45C9JQ45_HUMAN
Profilin
PFN2
110Annotation score:
C9J2N0C9J2N0_HUMAN
Profilin
PFN2
125Annotation score:
C9J712C9J712_HUMAN
Profilin
PFN2
91Annotation score:
C9J0J7C9J0J7_HUMAN
Profilin
PFN2
91Annotation score:
F2Z3G0F2Z3G0_HUMAN
Profilin-2
PFN2
55Annotation score:
C9J5V8C9J5V8_HUMAN
Profilin-2
PFN2
45Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti65T → A in AAH18049 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005217109 – 140VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. 3 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA Translation: AAA03022.1
AF228738 mRNA Translation: AAG24949.1
AK311780 mRNA Translation: BAG34723.1
AK311782 mRNA Translation: BAG34725.1
CH471052 Genomic DNA Translation: EAW78850.1
BC002964 mRNA No translation available.
CH471052 Genomic DNA Translation: EAW78852.1
BC018049 mRNA Translation: AAH18049.1
BC043646 mRNA Translation: AAH43646.1
BC095444 mRNA Translation: AAH95444.1
CCDSiCCDS3148.1 [P35080-1]
CCDS46934.1 [P35080-2]
PIRiS36804
RefSeqiNP_002619.1, NM_002628.4 [P35080-2]
NP_444252.1, NM_053024.3 [P35080-1]
UniGeneiHs.91747

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2]
GeneIDi5217
KEGGihsa:5217
UCSCiuc003ext.3 human [P35080-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA Translation: AAA03022.1
AF228738 mRNA Translation: AAG24949.1
AK311780 mRNA Translation: BAG34723.1
AK311782 mRNA Translation: BAG34725.1
CH471052 Genomic DNA Translation: EAW78850.1
BC002964 mRNA No translation available.
CH471052 Genomic DNA Translation: EAW78852.1
BC018049 mRNA Translation: AAH18049.1
BC043646 mRNA Translation: AAH43646.1
BC095444 mRNA Translation: AAH95444.1
CCDSiCCDS3148.1 [P35080-1]
CCDS46934.1 [P35080-2]
PIRiS36804
RefSeqiNP_002619.1, NM_002628.4 [P35080-2]
NP_444252.1, NM_053024.3 [P35080-1]
UniGeneiHs.91747

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D1JX-ray2.20A/B/C/D2-138[»]
ProteinModelPortaliP35080
SMRiP35080
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111238, 51 interactors
CORUMiP35080
IntActiP35080, 36 interactors
MINTiP35080
STRINGi9606.ENSP00000239940

Chemistry databases

DrugBankiDB02580 1-(2-Methoxy-Ethoxy)-2-{2-[2-(2-Methoxy-Ethoxy]-Ethoxy}-Ethane
DB02078 1-Methoxy-2-[2-(2-Methoxy-Ethoxy]-Ethane

PTM databases

iPTMnetiP35080
PhosphoSitePlusiP35080

Polymorphism and mutation databases

BioMutaiPFN2
DMDMi20178322

2D gel databases

REPRODUCTION-2DPAGEiP35080

Proteomic databases

EPDiP35080
MaxQBiP35080
PaxDbiP35080
PeptideAtlasiP35080
PRIDEiP35080
ProteomicsDBi54978
54979 [P35080-2]

Protocols and materials databases

DNASUi5217
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2]
GeneIDi5217
KEGGihsa:5217
UCSCiuc003ext.3 human [P35080-1]

Organism-specific databases

CTDi5217
DisGeNETi5217
EuPathDBiHostDB:ENSG00000070087.13
GeneCardsiPFN2
HGNCiHGNC:8882 PFN2
HPAiCAB037073
HPA035611
MIMi176590 gene
neXtProtiNX_P35080
OpenTargetsiENSG00000070087
PharmGKBiPA33220
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1755 Eukaryota
ENOG41126PD LUCA
GeneTreeiENSGT00390000010143
HOGENOMiHOG000171592
HOVERGENiHBG053683
InParanoidiP35080
KOiK05759
OMAiFFHMCSV
PhylomeDBiP35080
TreeFamiTF331744

Enzyme and pathway databases

ReactomeiR-HSA-376176 Signaling by ROBO receptors
R-HSA-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRSiPFN2 human
EvolutionaryTraceiP35080
GeneWikiiPFN2
GenomeRNAii5217
PROiPR:P35080
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000070087 Expressed in 238 organ(s), highest expression level in forebrain
CleanExiHS_PFN2
ExpressionAtlasiP35080 baseline and differential
GenevisibleiP35080 HS

Family and domain databases

CDDicd00148 PROF, 1 hit
InterProiView protein in InterPro
IPR005455 PFN
IPR029891 PFN2
IPR036140 PFN_sf
IPR005454 Profilin1/2/3_vertebrate
IPR027310 Profilin_CS
PANTHERiPTHR13936:SF15 PTHR13936:SF15, 1 hit
PfamiView protein in Pfam
PF00235 Profilin, 1 hit
PRINTSiPR00392 PROFILIN
PR01639 PROFILINMAML
SMARTiView protein in SMART
SM00392 PROF, 1 hit
SUPFAMiSSF55770 SSF55770, 1 hit
PROSITEiView protein in PROSITE
PS00414 PROFILIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPROF2_HUMAN
AccessioniPrimary (citable) accession number: P35080
Secondary accession number(s): B2R4C8
, D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2007
Last modified: October 10, 2018
This is version 188 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again