Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P35080 (PROF2_HUMAN)

Entry version 205 (07 Apr 2021)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Profilin-2

Gene

PFN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P35080

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-376176, Signaling by ROBO receptors
R-HSA-5663220, RHO GTPases Activate Formins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Profilin-2
Alternative name(s):
Profilin II
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PFN2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:8882, PFN2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		176590, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P35080

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000070087.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		5217

Open Targets

More...OpenTargetsi		ENSG00000070087

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33220

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P35080, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB02580, Pentaglyme
DB02078, Triglyme

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PFN2

Domain mapping of disease mutations (DMDM)

More...DMDMi		20178322

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001995752 – 140Profilin-2Add BLAST139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P35080

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P35080

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P35080

MaxQB - The MaxQuant DataBase

More...MaxQBi		P35080

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P35080

PeptideAtlas

More...PeptideAtlasi		P35080

PRoteomics IDEntifications database

More...PRIDEi		P35080

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54978 [P35080-1]
54979 [P35080-2]

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		P35080

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P35080

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P35080

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P35080

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P35080

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000070087, Expressed in forebrain and 250 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P35080, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P35080, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000070087, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (PubMed:7758455).

Interacts with PFN2 (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111238, 67 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P35080

Protein interaction database and analysis system

More...IntActi		P35080, 51 interactors

Molecular INTeraction database

More...MINTi		P35080

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000239940

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P35080, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1140
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		P35080

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P35080

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P35080

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the profilin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1755, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153664

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P35080

Identification of Orthologs from Complete Genome Data

More...OMAi		KAPASHC

Database of Orthologous Groups

More...OrthoDBi		1428600at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P35080

TreeFam database of animal gene trees

More...TreeFami		TF331744

Family and domain databases

Conserved Domains Database

More...CDDi		cd00148, PROF, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR005455, PFN
IPR029891, PFN2
IPR036140, PFN_sf
IPR005454, Profilin1/2/3_vertebrate
IPR027310, Profilin_CS

The PANTHER Classification System

More...PANTHERi		PTHR13936:SF15, PTHR13936:SF15, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00235, Profilin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00392, PROFILIN
PR01639, PROFILINMAML

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00392, PROF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF55770, SSF55770, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00414, PROFILIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform IIa (identifier: P35080-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPIEIDM 
        60         70         80         90        100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN 
       110        120        130        140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
Length:140
Mass (Da):15,046
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF43884E1427C9A99
GO
Isoform IIb (identifier: P35080-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHGGTLNKKAYELALYLRRSDV

Show »
Length:140
Mass (Da):15,088
Checksum:iB4CAC8A1ED8C658B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E9Q6G5E9Q6_HUMAN
Profilin
PFN2 hCG_21343
188Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J5V8C9J5V8_HUMAN
Profilin II
PFN2
45Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z3G0F2Z3G0_HUMAN
Profilin II
PFN2
55Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J2N0C9J2N0_HUMAN
Profilin
PFN2
125Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J712C9J712_HUMAN
Profilin
PFN2
91Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JQ45C9JQ45_HUMAN
Profilin
PFN2
110Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0J7C9J0J7_HUMAN
Profilin
PFN2
91Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti65T → A in AAH18049 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005217109 – 140VLVFV…RDSGF → ALVIVMGKEGVHGGTLNKKA YELALYLRRSDV in isoform IIb. 3 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L10678 mRNA Translation: AAA03022.1
AF228738 mRNA Translation: AAG24949.1
AK311780 mRNA Translation: BAG34723.1
AK311782 mRNA Translation: BAG34725.1
CH471052 Genomic DNA Translation: EAW78850.1
BC002964 mRNA No translation available.
CH471052 Genomic DNA Translation: EAW78852.1
BC018049 mRNA Translation: AAH18049.1
BC043646 mRNA Translation: AAH43646.1
BC095444 mRNA Translation: AAH95444.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3148.1 [P35080-1]
CCDS46934.1 [P35080-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S36804

NCBI Reference Sequences

More...RefSeqi		NP_002619.1, NM_002628.4 [P35080-2]
NP_444252.1, NM_053024.3 [P35080-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5217

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5217

UCSC genome browser

More...UCSCi		uc003ext.3, human [P35080-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L10678 mRNA Translation: AAA03022.1
AF228738 mRNA Translation: AAG24949.1
AK311780 mRNA Translation: BAG34723.1
AK311782 mRNA Translation: BAG34725.1
CH471052 Genomic DNA Translation: EAW78850.1
BC002964 mRNA No translation available.
CH471052 Genomic DNA Translation: EAW78852.1
BC018049 mRNA Translation: AAH18049.1
BC043646 mRNA Translation: AAH43646.1
BC095444 mRNA Translation: AAH95444.1
CCDSiCCDS3148.1 [P35080-1]
CCDS46934.1 [P35080-2]
PIRiS36804
RefSeqiNP_002619.1, NM_002628.4 [P35080-2]
NP_444252.1, NM_053024.3 [P35080-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1D1JX-ray2.20A/B/C/D2-138[»]
BMRBiP35080
SMRiP35080
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111238, 67 interactors
CORUMiP35080
IntActiP35080, 51 interactors
MINTiP35080
STRINGi9606.ENSP00000239940

Chemistry databases

DrugBankiDB02580, Pentaglyme
DB02078, Triglyme

PTM databases

iPTMnetiP35080
MetOSiteiP35080
PhosphoSitePlusiP35080
SwissPalmiP35080

Genetic variation databases

BioMutaiPFN2
DMDMi20178322

2D gel databases

REPRODUCTION-2DPAGEiP35080

Proteomic databases

EPDiP35080
jPOSTiP35080
MassIVEiP35080
MaxQBiP35080
PaxDbiP35080
PeptideAtlasiP35080
PRIDEiP35080
ProteomicsDBi54978 [P35080-1]
54979 [P35080-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		33583, 260 antibodies

The DNASU plasmid repository

More...DNASUi		5217

Genome annotation databases

EnsembliENST00000239940; ENSP00000239940; ENSG00000070087 [P35080-1]
ENST00000452853; ENSP00000410464; ENSG00000070087 [P35080-2]
GeneIDi5217
KEGGihsa:5217
UCSCiuc003ext.3, human [P35080-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5217
DisGeNETi5217

GeneCards: human genes, protein and diseases

More...GeneCardsi		PFN2
HGNCiHGNC:8882, PFN2
HPAiENSG00000070087, Tissue enhanced (brain)
MIMi176590, gene
neXtProtiNX_P35080
OpenTargetsiENSG00000070087
PharmGKBiPA33220
VEuPathDBiHostDB:ENSG00000070087.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1755, Eukaryota
GeneTreeiENSGT00940000153664
InParanoidiP35080
OMAiKAPASHC
OrthoDBi1428600at2759
PhylomeDBiP35080
TreeFamiTF331744

Enzyme and pathway databases

PathwayCommonsiP35080
ReactomeiR-HSA-376176, Signaling by ROBO receptors
R-HSA-5663220, RHO GTPases Activate Formins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5217, 1 hit in 989 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PFN2, human
EvolutionaryTraceiP35080

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PFN2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5217
PharosiP35080, Tbio

Protein Ontology

More...PROi		PR:P35080
RNActiP35080, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000070087, Expressed in forebrain and 250 other tissues
ExpressionAtlasiP35080, baseline and differential
GenevisibleiP35080, HS

Family and domain databases

CDDicd00148, PROF, 1 hit
InterProiView protein in InterPro
IPR005455, PFN
IPR029891, PFN2
IPR036140, PFN_sf
IPR005454, Profilin1/2/3_vertebrate
IPR027310, Profilin_CS
PANTHERiPTHR13936:SF15, PTHR13936:SF15, 1 hit
PfamiView protein in Pfam
PF00235, Profilin, 1 hit
PRINTSiPR00392, PROFILIN
PR01639, PROFILINMAML
SMARTiView protein in SMART
SM00392, PROF, 1 hit
SUPFAMiSSF55770, SSF55770, 1 hit
PROSITEiView protein in PROSITE
PS00414, PROFILIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPROF2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35080
Secondary accession number(s): B2R4C8
, D3DNI4, Q4VBQ4, Q8WVF9, Q9HBK2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: January 23, 2007
Last modified: April 7, 2021
This is version 205 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again