Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trypsin-3

Gene

PRSS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors.6 Publications

Catalytic activityi

Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.7 Publications

Cofactori

Ca2+2 PublicationsNote: Binds 1 Ca2+ ion per subunit.3 Publications

Activity regulationi

Not inhibited by Kunitz-type trypsin inhibitors.2 Publications

pH dependencei

Optimum pH is 8.5.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei120Charge relay systemPROSITE-ProRule annotation1 Publication1
Metal bindingi132CalciumCombined sources3 Publications1
Metal bindingi134Calcium; via carbonyl oxygenCombined sources3 Publications1
Metal bindingi137Calcium; via carbonyl oxygenCombined sources3 Publications1
Metal bindingi139CalciumCombined sources3 Publications1
Metal bindingi142CalciumCombined sources3 Publications1
Active sitei164Charge relay systemPROSITE-ProRule annotation1 Publication1
Sitei251Required for specificityBy similarity1
Active sitei257Charge relay systemPROSITE-ProRule annotation1 Publication1

GO - Molecular functioni

GO - Biological processi

  • antimicrobial humoral response Source: Reactome
  • cobalamin metabolic process Source: Reactome
  • digestion Source: UniProtKB
  • endothelial cell migration Source: UniProtKB
  • neutrophil degranulation Source: Reactome
  • proteolysis Source: UniProtKB
  • zymogen activation Source: UniProtKB

Keywordsi

Molecular functionHydrolase, Protease, Serine protease
Biological processDigestion
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-1462054 Alpha-defensins
R-HSA-196741 Cobalamin (Cbl, vitamin B12) transport and metabolism
R-HSA-6798695 Neutrophil degranulation
R-HSA-6803157 Antimicrobial peptides

Protein family/group databases

MEROPSiS01.174

Names & Taxonomyi

Protein namesi
Recommended name:
Trypsin-3 (EC:3.4.21.47 Publications)
Alternative name(s):
Brain trypsinogen1 Publication
Mesotrypsin1 Publication
Mesotrypsinogen1 Publication
Serine protease 3
Serine protease 4
Trypsin III
Trypsin IV1 Publication
Gene namesi
Name:PRSS3
Synonyms:PRSS4, TRY3, TRY4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000010438.16
HGNCiHGNC:9486 PRSS3
MIMi613578 gene
neXtProtiNX_P35030

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi257S → A: Loss of catalytic activity. 1 Publication1

Organism-specific databases

DisGeNETi5646
OpenTargetsiENSG00000010438
PharmGKBiPA33838

Chemistry databases

ChEMBLiCHEMBL4551
DrugBankiDB02585 4-(Hydroxymethyl)Benzamidine
DB02541 4-Hydroxybutan-1-Aminium
DB03127 Benzamidine
DB03637 Guanidine-3-Propanol
GuidetoPHARMACOLOGYi2399

Polymorphism and mutation databases

BioMutaiPRSS3
DMDMi209572698

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
PropeptideiPRO_0000028201? – 80Activation peptide
Signal peptidei1 – ?Sequence analysis
ChainiPRO_000002820281 – 304Trypsin-3Add BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi87 ↔ 217Combined sources4 Publications
Disulfide bondi105 ↔ 121Combined sources4 Publications
Disulfide bondi196 ↔ 263Combined sources4 Publications
Modified residuei211SulfotyrosineBy similarity1
Disulfide bondi228 ↔ 242Combined sources4 Publications
Disulfide bondi253 ↔ 277Combined sources4 Publications

Keywords - PTMi

Disulfide bond, Sulfation, Zymogen

Proteomic databases

EPDiP35030
MaxQBiP35030
PaxDbiP35030
PeptideAtlasiP35030
PRIDEiP35030
ProteomicsDBi54972
54973 [P35030-2]
54974 [P35030-3]
54975 [P35030-4]

PTM databases

iPTMnetiP35030
PhosphoSitePlusiP35030

Expressioni

Tissue specificityi

Detected in pancreas and pancreatic fluid (at protein level) (PubMed:6698368). Expressed in pancreas and brain (PubMed:8294000). Detected in ileum (PubMed:12021776).3 Publications

Gene expression databases

BgeeiENSG00000010438 Expressed in 164 organ(s), highest expression level in duodenum
CleanExiHS_PRSS3
ExpressionAtlasiP35030 baseline and differential
GenevisibleiP35030 HS

Organism-specific databases

HPAiHPA062452
HPA063471

Interactioni

Protein-protein interaction databases

BioGridi111628, 11 interactors
IntActiP35030, 8 interactors
MINTiP35030
STRINGi9606.ENSP00000354280

Chemistry databases

BindingDBiP35030

Structurei

Secondary structure

1304
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP35030
SMRiP35030
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP35030

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini81 – 301Peptidase S1PROSITE-ProRule annotationAdd BLAST221

Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00760000118862
HOGENOMiHOG000251820
HOVERGENiHBG013304
InParanoidiP35030
KOiK01312
OMAiRHASWIN
OrthoDBiEOG091G0DF7
PhylomeDBiP35030
TreeFamiTF331065

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P35030-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCGPDDRCPA RWPGPGRAVK CGKGLAAARP GRVERGGAQR GGAGLELHPL
60 70 80 90 100
LGGRTWRAAR DADGCEALGT VAVPFDDDDK IVGGYTCEEN SLPYQVSLNS
110 120 130 140 150
GSHFCGGSLI SEQWVVSAAH CYKTRIQVRL GEHNIKVLEG NEQFINAAKI
160 170 180 190 200
IRHPKYNRDT LDNDIMLIKL SSPAVINARV STISLPTTPP AAGTECLISG
210 220 230 240 250
WGNTLSFGAD YPDELKCLDA PVLTQAECKA SYPGKITNSM FCVGFLEGGK
260 270 280 290 300
DSCQRDSGGP VVCNGQLQGV VSWGHGCAWK NRPGVYTKVY NYVDWIKDTI

AANS
Length:304
Mass (Da):32,529
Last modified:October 14, 2008 - v2
Checksum:i4C4303C310B7BFFC
GO
Isoform 2 (identifier: P35030-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGL → M

Show »
Length:260
Mass (Da):28,161
Checksum:iCD8AA6E8072BCE56
GO
Isoform 3 (identifier: P35030-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MNPFLILAFVGAA

Show »
Length:247
Mass (Da):26,727
Checksum:i01563656780A6607
GO
Isoform 4 (identifier: P35030-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MCGPDDRCPA...ADGCEALGTV → MHMRETSGFTLKKGRSAPLVFHPPDALI

Show »
Length:261
Mass (Da):28,402
Checksum:i5908225118767A4A
GO
Isoform 5 (identifier: P35030-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MGPAGE

Show »
Length:240
Mass (Da):25,924
Checksum:iE8DF46CFF536DB74
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AN99B1AN99_HUMAN
Trypsin-3
PRSS3
177Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti89Missing in CAA50484 (PubMed:8294000).Curated1
Sequence conflicti224 – 225TQ → RE in CAA33527 (PubMed:2326201).Curated2
Sequence conflicti253 – 254CQ → WK in CAA33527 (PubMed:2326201).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_067459174A → V. Corresponds to variant dbSNP:rs11547028Ensembl.1
Natural variantiVAR_046794188T → A7 PublicationsCorresponds to variant dbSNP:rs855581Ensembl.1
Natural variantiVAR_059788224T → S. Corresponds to variant dbSNP:rs1063273Ensembl.1
Natural variantiVAR_046795232Y → C1 PublicationCorresponds to variant dbSNP:rs1048379Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0054091 – 71MCGPD…ALGTV → MHMRETSGFTLKKGRSAPLV FHPPDALI in isoform 4. CuratedAdd BLAST71
Alternative sequenceiVSP_0054101 – 70MCGPD…EALGT → MNPFLILAFVGAA in isoform 3. 3 PublicationsAdd BLAST70
Alternative sequenceiVSP_0537791 – 70MCGPD…EALGT → MGPAGE in isoform 5. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_0420741 – 45MCGPD…GGAGL → M in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X72781 mRNA Translation: CAB58178.1
X71345 mRNA Translation: CAA50484.1
X15505 mRNA Translation: CAA33527.1
D45417 mRNA Translation: BAA08257.1
AF029308 Genomic DNA Translation: AAC13322.1
AB298285 mRNA Translation: BAF80324.1
AB298286 mRNA Translation: BAF80325.1
AL139113 Genomic DNA No translation available.
AL356489 Genomic DNA No translation available.
AL358573 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58482.1
CH471071 Genomic DNA Translation: EAW58484.1
BC069476 mRNA Translation: AAH69476.1
BC069494 mRNA Translation: AAH69494.1
CCDSiCCDS47958.1 [P35030-1]
CCDS56570.1 [P35030-5]
CCDS56571.1 [P35030-4]
CCDS6545.1 [P35030-3]
PIRiS12764
S33496
RefSeqiNP_001184026.2, NM_001197097.2
NP_001184027.1, NM_001197098.1
NP_002762.2, NM_002771.3
NP_031369.2, NM_007343.3
UniGeneiHs.654513

Genome annotation databases

EnsembliENST00000342836; ENSP00000340889; ENSG00000010438 [P35030-4]
ENST00000361005; ENSP00000354280; ENSG00000010438 [P35030-1]
ENST00000379405; ENSP00000368715; ENSG00000010438 [P35030-3]
ENST00000429677; ENSP00000401828; ENSG00000010438 [P35030-5]
GeneIDi5646
KEGGihsa:5646
UCSCiuc003zti.5 human [P35030-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X72781 mRNA Translation: CAB58178.1
X71345 mRNA Translation: CAA50484.1
X15505 mRNA Translation: CAA33527.1
D45417 mRNA Translation: BAA08257.1
AF029308 Genomic DNA Translation: AAC13322.1
AB298285 mRNA Translation: BAF80324.1
AB298286 mRNA Translation: BAF80325.1
AL139113 Genomic DNA No translation available.
AL356489 Genomic DNA No translation available.
AL358573 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58482.1
CH471071 Genomic DNA Translation: EAW58484.1
BC069476 mRNA Translation: AAH69476.1
BC069494 mRNA Translation: AAH69494.1
CCDSiCCDS47958.1 [P35030-1]
CCDS56570.1 [P35030-5]
CCDS56571.1 [P35030-4]
CCDS6545.1 [P35030-3]
PIRiS12764
S33496
RefSeqiNP_001184026.2, NM_001197097.2
NP_001184027.1, NM_001197098.1
NP_002762.2, NM_002771.3
NP_031369.2, NM_007343.3
UniGeneiHs.654513

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1H4WX-ray1.70A81-304[»]
2R9PX-ray1.40A/B/C/D81-304[»]
3L33X-ray2.48A/B/C/D81-304[»]
3L3TX-ray2.38A/B/C/D81-304[»]
3P92X-ray1.60A81-304[»]
3P95X-ray1.30A81-304[»]
4DG4X-ray1.40A/B/D/G81-304[»]
4U30X-ray2.50A/B/C/D81-304[»]
4U32X-ray1.65A81-304[»]
5C67X-ray1.83A/B81-304[»]
5JBTX-ray1.40A81-304[»]
5TP0X-ray1.25A81-304[»]
ProteinModelPortaliP35030
SMRiP35030
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111628, 11 interactors
IntActiP35030, 8 interactors
MINTiP35030
STRINGi9606.ENSP00000354280

Chemistry databases

BindingDBiP35030
ChEMBLiCHEMBL4551
DrugBankiDB02585 4-(Hydroxymethyl)Benzamidine
DB02541 4-Hydroxybutan-1-Aminium
DB03127 Benzamidine
DB03637 Guanidine-3-Propanol
GuidetoPHARMACOLOGYi2399

Protein family/group databases

MEROPSiS01.174

PTM databases

iPTMnetiP35030
PhosphoSitePlusiP35030

Polymorphism and mutation databases

BioMutaiPRSS3
DMDMi209572698

Proteomic databases

EPDiP35030
MaxQBiP35030
PaxDbiP35030
PeptideAtlasiP35030
PRIDEiP35030
ProteomicsDBi54972
54973 [P35030-2]
54974 [P35030-3]
54975 [P35030-4]

Protocols and materials databases

DNASUi5646
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342836; ENSP00000340889; ENSG00000010438 [P35030-4]
ENST00000361005; ENSP00000354280; ENSG00000010438 [P35030-1]
ENST00000379405; ENSP00000368715; ENSG00000010438 [P35030-3]
ENST00000429677; ENSP00000401828; ENSG00000010438 [P35030-5]
GeneIDi5646
KEGGihsa:5646
UCSCiuc003zti.5 human [P35030-1]

Organism-specific databases

CTDi5646
DisGeNETi5646
EuPathDBiHostDB:ENSG00000010438.16
GeneCardsiPRSS3
H-InvDBiHIX0035151
HGNCiHGNC:9486 PRSS3
HPAiHPA062452
HPA063471
MIMi613578 gene
neXtProtiNX_P35030
OpenTargetsiENSG00000010438
PharmGKBiPA33838
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00760000118862
HOGENOMiHOG000251820
HOVERGENiHBG013304
InParanoidiP35030
KOiK01312
OMAiRHASWIN
OrthoDBiEOG091G0DF7
PhylomeDBiP35030
TreeFamiTF331065

Enzyme and pathway databases

ReactomeiR-HSA-1462054 Alpha-defensins
R-HSA-196741 Cobalamin (Cbl, vitamin B12) transport and metabolism
R-HSA-6798695 Neutrophil degranulation
R-HSA-6803157 Antimicrobial peptides

Miscellaneous databases

ChiTaRSiPRSS3 human
EvolutionaryTraceiP35030
GenomeRNAii5646
PROiPR:P35030
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000010438 Expressed in 164 organ(s), highest expression level in duodenum
CleanExiHS_PRSS3
ExpressionAtlasiP35030 baseline and differential
GenevisibleiP35030 HS

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTRY3_HUMAN
AccessioniPrimary (citable) accession number: P35030
Secondary accession number(s): A8CED1
, A8CED3, A9Z1Y4, E7ES07, F8W7P3, P15951, Q15665, Q5VXV0, Q6ISJ4, Q9UQV3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: October 14, 2008
Last modified: November 7, 2018
This is version 185 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again