Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P35030 (TRY3_HUMAN)

Protein

Trypsin-3

Gene

PRSS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors.6 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+2 PublicationsNote: Binds 1 Ca2+ ion per subunit.3 Publications

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Not inhibited by Kunitz-type trypsin inhibitors.2 Publications

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>pH dependencei

Optimum pH is 8.5.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei120Charge relay systemPROSITE-ProRule annotation1 Publication1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi132CalciumCombined sources3 Publications1
Metal bindingi134Calcium; via carbonyl oxygenCombined sources3 Publications1
Metal bindingi137Calcium; via carbonyl oxygenCombined sources3 Publications1
Metal bindingi139CalciumCombined sources3 Publications1
Metal bindingi142CalciumCombined sources3 Publications1
Active sitei164Charge relay systemPROSITE-ProRule annotation1 Publication1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei251Required for specificityBy similarity1
Active sitei257Charge relay systemPROSITE-ProRule annotation1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

  • antimicrobial humoral response Source: Reactome
  • cobalamin metabolic process Source: Reactome
  • digestion Source: UniProtKB
  • endothelial cell migration Source: UniProtKB
  • neutrophil degranulation Source: Reactome
  • proteolysis Source: UniProtKB
  • zymogen activation Source: UniProtKB
View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease
Biological processDigestion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1462054 Alpha-defensins
R-HSA-196741 Cobalamin (Cbl, vitamin B12) transport and metabolism
R-HSA-6798695 Neutrophil degranulation
R-HSA-6803157 Antimicrobial peptides

Protein family/group databases

MEROPS protease database

More...MEROPSi		S01.174

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Trypsin-3 (EC:3.4.21.47 Publications)
Alternative name(s):
Brain trypsinogen1 Publication
Mesotrypsin1 Publication
Mesotrypsinogen1 Publication
Serine protease 3
Serine protease 4
Trypsin III
Trypsin IV1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PRSS3
Synonyms:PRSS4, TRY3, TRY4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000010438.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:9486 PRSS3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613578 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P35030

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi257S → A: Loss of catalytic activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		5646

Open Targets

More...OpenTargetsi		ENSG00000010438

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33838

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4551

Drug and drug target database

More...DrugBanki		DB02585 4-(Hydroxymethyl)Benzamidine
DB02541 4-Hydroxybutan-1-Aminium
DB03127 Benzamidine
DB03637 Guanidine-3-Propanol

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		2399

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PRSS3

Domain mapping of disease mutations (DMDM)

More...DMDMi		209572698

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000028201? – 80Activation peptide
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – ?Sequence analysis
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002820281 – 304Trypsin-3Add BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi87 ↔ 217Combined sources4 Publications
Disulfide bondi105 ↔ 121Combined sources4 Publications
Disulfide bondi196 ↔ 263Combined sources4 Publications
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei211SulfotyrosineBy similarity1
Disulfide bondi228 ↔ 242Combined sources4 Publications
Disulfide bondi253 ↔ 277Combined sources4 Publications

Keywords - PTMi

Disulfide bond, Sulfation, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P35030

MaxQB - The MaxQuant DataBase

More...MaxQBi		P35030

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P35030

PeptideAtlas

More...PeptideAtlasi		P35030

PRoteomics IDEntifications database

More...PRIDEi		P35030

ProteomicsDB human proteome resource

More...ProteomicsDBi		54972
54973 [P35030-2]
54974 [P35030-3]
54975 [P35030-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P35030

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P35030

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in pancreas and pancreatic fluid (at protein level) (PubMed:6698368). Expressed in pancreas and brain (PubMed:8294000). Detected in ileum (PubMed:12021776).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000010438 Expressed in 164 organ(s), highest expression level in duodenum

CleanEx database of gene expression profiles

More...CleanExi		HS_PRSS3

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P35030 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P35030 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA062452
HPA063471

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		111628, 10 interactors

Protein interaction database and analysis system

More...IntActi		P35030, 12 interactors

Molecular INTeraction database

More...MINTi		P35030

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000354280

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P35030

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1304
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P35030

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P35030

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P35030

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 301Peptidase S1PROSITE-ProRule annotationAdd BLAST221

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3627 Eukaryota
COG5640 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153485

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000251820

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG013304

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P35030

KEGG Orthology (KO)

More...KOi		K01312

Identification of Orthologs from Complete Genome Data

More...OMAi		RHASWIN

Database of Orthologous Groups

More...OrthoDBi		EOG091G0DF7

Database for complete collections of gene phylogenies

More...PhylomeDBi		P35030

TreeFam database of animal gene trees

More...TreeFami		TF331065

Family and domain databases

Conserved Domains Database

More...CDDi		cd00190 Tryp_SPc, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00089 Trypsin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00722 CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00020 Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50494 SSF50494, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P35030-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCGPDDRCPA RWPGPGRAVK CGKGLAAARP GRVERGGAQR GGAGLELHPL 
        60         70         80         90        100
LGGRTWRAAR DADGCEALGT VAVPFDDDDK IVGGYTCEEN SLPYQVSLNS 
       110        120        130        140        150
GSHFCGGSLI SEQWVVSAAH CYKTRIQVRL GEHNIKVLEG NEQFINAAKI 
       160        170        180        190        200
IRHPKYNRDT LDNDIMLIKL SSPAVINARV STISLPTTPP AAGTECLISG 
       210        220        230        240        250
WGNTLSFGAD YPDELKCLDA PVLTQAECKA SYPGKITNSM FCVGFLEGGK 
       260        270        280        290        300
DSCQRDSGGP VVCNGQLQGV VSWGHGCAWK NRPGVYTKVY NYVDWIKDTI 

AANS
Length:304
Mass (Da):32,529
Last modified:October 14, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C4303C310B7BFFC
GO
Isoform 2 (identifier: P35030-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGL → M

Show »
Length:260
Mass (Da):28,161
Checksum:iCD8AA6E8072BCE56
GO
Isoform 3 (identifier: P35030-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MNPFLILAFVGAA

Show »
Length:247
Mass (Da):26,727
Checksum:i01563656780A6607
GO
Isoform 4 (identifier: P35030-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: MCGPDDRCPA...ADGCEALGTV → MHMRETSGFTLKKGRSAPLVFHPPDALI

Show »
Length:261
Mass (Da):28,402
Checksum:i5908225118767A4A
GO
Isoform 5 (identifier: P35030-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MCGPDDRCPA...DADGCEALGT → MGPAGE

Show »
Length:240
Mass (Da):25,924
Checksum:iE8DF46CFF536DB74
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AN99B1AN99_HUMAN
Trypsin-3
PRSS3
177Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti89Missing in CAA50484 (PubMed:8294000).Curated1
Sequence conflicti224 – 225TQ → RE in CAA33527 (PubMed:2326201).Curated2
Sequence conflicti253 – 254CQ → WK in CAA33527 (PubMed:2326201).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_067459174A → V. Corresponds to variant dbSNP:rs11547028Ensembl.1
Natural variantiVAR_046794188T → A7 PublicationsCorresponds to variant dbSNP:rs855581Ensembl.1
Natural variantiVAR_059788224T → S. Corresponds to variant dbSNP:rs1063273Ensembl.1
Natural variantiVAR_046795232Y → C1 PublicationCorresponds to variant dbSNP:rs1048379Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0054091 – 71MCGPD…ALGTV → MHMRETSGFTLKKGRSAPLV FHPPDALI in isoform 4. CuratedAdd BLAST71
Alternative sequenceiVSP_0054101 – 70MCGPD…EALGT → MNPFLILAFVGAA in isoform 3. 3 PublicationsAdd BLAST70
Alternative sequenceiVSP_0537791 – 70MCGPD…EALGT → MGPAGE in isoform 5. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_0420741 – 45MCGPD…GGAGL → M in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X72781 mRNA Translation: CAB58178.1
X71345 mRNA Translation: CAA50484.1
X15505 mRNA Translation: CAA33527.1
D45417 mRNA Translation: BAA08257.1
AF029308 Genomic DNA Translation: AAC13322.1
AB298285 mRNA Translation: BAF80324.1
AB298286 mRNA Translation: BAF80325.1
AL139113 Genomic DNA No translation available.
AL356489 Genomic DNA No translation available.
AL358573 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58482.1
CH471071 Genomic DNA Translation: EAW58484.1
BC069476 mRNA Translation: AAH69476.1
BC069494 mRNA Translation: AAH69494.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47958.1 [P35030-1]
CCDS56570.1 [P35030-5]
CCDS56571.1 [P35030-4]
CCDS6545.1 [P35030-3]

Protein sequence database of the Protein Information Resource

More...PIRi		S12764
S33496

NCBI Reference Sequences

More...RefSeqi		NP_001184026.2, NM_001197097.2
NP_001184027.1, NM_001197098.1
NP_002762.2, NM_002771.3
NP_031369.2, NM_007343.3

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.654513

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000342836; ENSP00000340889; ENSG00000010438 [P35030-4]
ENST00000361005; ENSP00000354280; ENSG00000010438 [P35030-1]
ENST00000379405; ENSP00000368715; ENSG00000010438 [P35030-3]
ENST00000429677; ENSP00000401828; ENSG00000010438 [P35030-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5646

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5646

UCSC genome browser

More...UCSCi		uc003zti.5 human [P35030-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X72781 mRNA Translation: CAB58178.1
X71345 mRNA Translation: CAA50484.1
X15505 mRNA Translation: CAA33527.1
D45417 mRNA Translation: BAA08257.1
AF029308 Genomic DNA Translation: AAC13322.1
AB298285 mRNA Translation: BAF80324.1
AB298286 mRNA Translation: BAF80325.1
AL139113 Genomic DNA No translation available.
AL356489 Genomic DNA No translation available.
AL358573 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58482.1
CH471071 Genomic DNA Translation: EAW58484.1
BC069476 mRNA Translation: AAH69476.1
BC069494 mRNA Translation: AAH69494.1
CCDSiCCDS47958.1 [P35030-1]
CCDS56570.1 [P35030-5]
CCDS56571.1 [P35030-4]
CCDS6545.1 [P35030-3]
PIRiS12764
S33496
RefSeqiNP_001184026.2, NM_001197097.2
NP_001184027.1, NM_001197098.1
NP_002762.2, NM_002771.3
NP_031369.2, NM_007343.3
UniGeneiHs.654513

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1H4WX-ray1.70A81-304[»]
2R9PX-ray1.40A/B/C/D81-304[»]
3L33X-ray2.48A/B/C/D81-304[»]
3L3TX-ray2.38A/B/C/D81-304[»]
3P92X-ray1.60A81-304[»]
3P95X-ray1.30A81-304[»]
4DG4X-ray1.40A/B/D/G81-304[»]
4U30X-ray2.50A/B/C/D81-304[»]
4U32X-ray1.65A81-304[»]
5C67X-ray1.83A/B81-304[»]
5JBTX-ray1.40A81-304[»]
5TP0X-ray1.25A81-304[»]
ProteinModelPortaliP35030
SMRiP35030
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111628, 10 interactors
IntActiP35030, 12 interactors
MINTiP35030
STRINGi9606.ENSP00000354280

Chemistry databases

BindingDBiP35030
ChEMBLiCHEMBL4551
DrugBankiDB02585 4-(Hydroxymethyl)Benzamidine
DB02541 4-Hydroxybutan-1-Aminium
DB03127 Benzamidine
DB03637 Guanidine-3-Propanol
GuidetoPHARMACOLOGYi2399

Protein family/group databases

MEROPSiS01.174

PTM databases

iPTMnetiP35030
PhosphoSitePlusiP35030

Polymorphism and mutation databases

BioMutaiPRSS3
DMDMi209572698

Proteomic databases

EPDiP35030
MaxQBiP35030
PaxDbiP35030
PeptideAtlasiP35030
PRIDEiP35030
ProteomicsDBi54972
54973 [P35030-2]
54974 [P35030-3]
54975 [P35030-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		5646
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342836; ENSP00000340889; ENSG00000010438 [P35030-4]
ENST00000361005; ENSP00000354280; ENSG00000010438 [P35030-1]
ENST00000379405; ENSP00000368715; ENSG00000010438 [P35030-3]
ENST00000429677; ENSP00000401828; ENSG00000010438 [P35030-5]
GeneIDi5646
KEGGihsa:5646
UCSCiuc003zti.5 human [P35030-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5646
DisGeNETi5646
EuPathDBiHostDB:ENSG00000010438.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		PRSS3

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0035151
HGNCiHGNC:9486 PRSS3
HPAiHPA062452
HPA063471
MIMi613578 gene
neXtProtiNX_P35030
OpenTargetsiENSG00000010438
PharmGKBiPA33838

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00940000153485
HOGENOMiHOG000251820
HOVERGENiHBG013304
InParanoidiP35030
KOiK01312
OMAiRHASWIN
OrthoDBiEOG091G0DF7
PhylomeDBiP35030
TreeFamiTF331065

Enzyme and pathway databases

ReactomeiR-HSA-1462054 Alpha-defensins
R-HSA-196741 Cobalamin (Cbl, vitamin B12) transport and metabolism
R-HSA-6798695 Neutrophil degranulation
R-HSA-6803157 Antimicrobial peptides

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PRSS3 human
EvolutionaryTraceiP35030

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5646

Protein Ontology

More...PROi		PR:P35030

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000010438 Expressed in 164 organ(s), highest expression level in duodenum
CleanExiHS_PRSS3
ExpressionAtlasiP35030 baseline and differential
GenevisibleiP35030 HS

Family and domain databases

CDDicd00190 Tryp_SPc, 1 hit
InterProiView protein in InterPro
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
PfamiView protein in Pfam
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
PROSITEiView protein in PROSITE
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRY3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P35030
Secondary accession number(s): A8CED1
, A8CED3, A9Z1Y4, E7ES07, F8W7P3, P15951, Q15665, Q5VXV0, Q6ISJ4, Q9UQV3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: October 14, 2008
Last modified: December 5, 2018
This is version 186 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again