Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P34998 (CRFR1_HUMAN)

Entry version 202 (17 Jun 2020)
Sequence version 1 (01 Feb 1994)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Corticotropin-releasing factor receptor 1

Gene

CRHR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-373080 Class B/2 (Secretin family receptors)
R-HSA-418555 G alpha (s) signalling events

SIGNOR Signaling Network Open Resource

More...SIGNORi		P34998

Protein family/group databases

Transport Classification Database

More...TCDBi		9.A.14.4.3 the g-protein-coupled receptor (gpcr) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Corticotropin-releasing factor receptor 1
Short name:
CRF-R-1
Short name:
CRF-R1
Short name:
CRFR-1
Alternative name(s):
Corticotropin-releasing hormone receptor 1
Short name:
CRH-R-1
Short name:
CRH-R1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CRHR1
Synonyms:CRFR, CRFR1, CRHR
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000120088.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:2357 CRHR1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		122561 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P34998

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 111ExtracellularAdd BLAST88
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei112 – 142Helical; Name=1Add BLAST31
Topological domaini143 – 178CytoplasmicAdd BLAST36
Transmembranei179 – 203Helical; Name=2Add BLAST25
Topological domaini204 – 218ExtracellularAdd BLAST15
Transmembranei219 – 247Helical; Name=3Add BLAST29
Topological domaini248 – 254Cytoplasmic7
Transmembranei255 – 282Helical; Name=4Add BLAST28
Topological domaini283 – 298ExtracellularAdd BLAST16
Transmembranei299 – 324Helical; Name=5Add BLAST26
Topological domaini325 – 335CytoplasmicAdd BLAST11
Transmembranei336 – 360Helical; Name=6Add BLAST25
Topological domaini361 – 367Extracellular7
Transmembranei368 – 397Helical; Name=7Add BLAST30
Topological domaini398 – 444CytoplasmicAdd BLAST47

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi232F → A: Nearly abolishes antagonist binding. 1 Publication1
Mutagenesisi235M → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi309L → A: Nearly abolishes antagonist binding. 1 Publication1
Mutagenesisi312N → A: Nearly abolishes antagonist binding. 1 Publication1
Mutagenesisi313F → A: Slightly reduces antagonist binding. 1 Publication1
Mutagenesisi316L → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi319I → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi356Y → A: Strongly reduces antagonist binding. 1 Publication1
Mutagenesisi384Q → A: Increases antagonist binding. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		104909134
1394

Open Targets

More...OpenTargetsi		ENSG00000120088
ENSG00000263715

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26874

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P34998 Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1800

Drug and drug target database

More...DrugBanki		DB09067 Corticorelin ovine triflutate

DrugCentral

More...DrugCentrali		P34998

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		212

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CRHR1

Domain mapping of disease mutations (DMDM)

More...DMDMi		461836

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 231 PublicationAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001281424 – 444Corticotropin-releasing factor receptor 1Add BLAST421

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi30 ↔ 54
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi38N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi44 ↔ 87
Glycosylationi45N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi68 ↔ 102
Glycosylationi78N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi90N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi98N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi217 ↔ 287
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei330Phosphoserine; by PKA1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

C-terminal Ser or Thr residues may be phosphorylated.1 Publication
Phosphorylation at Ser-330 by PKA prevents maximal coupling to Gq-protein, and thereby negatively regulates downstream signaling.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P34998

PeptideAtlas

More...PeptideAtlasi		P34998

PRoteomics IDEntifications database

More...PRIDEi		P34998

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4300
54968 [P34998-1]
54969 [P34998-2]
54970 [P34998-3]
54971 [P34998-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P34998

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P34998

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000120088 Expressed in pituitary gland and 62 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P34998 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P34998 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000120088 Group enriched (brain, pituitary gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer; heterodimerizes with GPER1 (By similarity).

Interacts (via N-terminal extracellular domain) with CRH and UCN.

Interacts with DLG1; this inhibits endocytosis of CRHR1 after agonist binding.

By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107784, 18 interactors

Protein interaction database and analysis system

More...IntActi		P34998, 7 interactors

Molecular INTeraction database

More...MINTi		P34998

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000381333

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P34998

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P34998 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1444
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P34998

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P34998

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni99 – 108Important for peptide agonist binding10
Regioni309 – 319Important for antagonist bindingAdd BLAST11

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The transmembrane domain is composed of seven transmembrane helices that are arranged in V-shape. Transmembrane helix 7 assumes a sharply kinked structure. The antagonist CP-376395 binds at an allosteric site, far from the presumed binding site for the physiological peptide ligand.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 2 family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4564 Eukaryota
ENOG410XRS2 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158410

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P34998

KEGG Orthology (KO)

More...KOi		K04578

Identification of Orthologs from Complete Genome Data

More...OMAi		VHYHIAV

Database of Orthologous Groups

More...OrthoDBi		1163977at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P34998

TreeFam database of animal gene trees

More...TreeFami		TF315710

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		4.10.1240.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR017981 GPCR_2-like
IPR003052 GPCR_2_CRF1_rcpt
IPR003051 GPCR_2_CRF_rcpt
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00002 7tm_2, 1 hit
PF02793 HRM, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01279 CRFRECEPTOR
PR01280 CRFRECEPTOR1
PR00249 GPCRSECRETIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00008 HormR, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF111418 SSF111418, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00649 G_PROTEIN_RECEP_F2_1, 1 hit
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform CRF-R1 (identifier: P34998-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGHPQLRLV KALLLLGLNP VSASLQDQHC ESLSLASNIS GLQCNASVDL 
        60         70         80         90        100
IGTCWPRSPA GQLVVRPCPA FFYGVRYNTT NNGYRECLAN GSWAARVNYS 
       110        120        130        140        150
ECQEILNEEK KSKVHYHVAV IINYLGHCIS LVALLVAFVL FLRLRPGCTH 
       160        170        180        190        200
WGDQADGALE VGAPWSGAPF QVRRSIRCLR NIIHWNLISA FILRNATWFV 
       210        220        230        240        250
VQLTMSPEVH QSNVGWCRLV TAAYNYFHVT NFFWMFGEGC YLHTAIVLTY 
       260        270        280        290        300
STDRLRKWMF ICIGWGVPFP IIVAWAIGKL YYDNEKCWFG KRPGVYTDYI 
       310        320        330        340        350
YQGPMILVLL INFIFLFNIV RILMTKLRAS TTSETIQYRK AVKATLVLLP 
       360        370        380        390        400
LLGITYMLFF VNPGEDEVSR VVFIYFNSFL ESFQGFFVSV FYCFLNSEVR 
       410        420        430        440 
SAIRKRWHRW QDKHSIRARV ARAMSIPTSP TRVSFHSIKQ STAV
Length:444
Mass (Da):50,719
Last modified:February 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7221AEFB0E7AA8ED
GO
Isoform CRF-R2 (identifier: P34998-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-174: Missing.

Note: Major isoform.Curated
Show »
Length:415
Mass (Da):47,671
Checksum:i81445283CCE34C6E
GO
Isoform CRF-R3 (identifier: P34998-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     41-81: GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN → D
     146-174: Missing.

Note: Does not bind to CRF with high affinity.Curated
Show »
Length:375
Mass (Da):43,331
Checksum:i6A2068BE9386F8B0
GO
Isoform CRF-R4 (identifier: P34998-4) [UniParc]FASTAAdd to basket
Also known as: 1D

The sequence of this isoform differs from the canonical sequence as follows:
     146-174: Missing.
     385-398: Missing.

Show »
Length:401
Mass (Da):46,030
Checksum:i3D8FF9B128810372
GO
Isoform 5 (identifier: P34998-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-204: Missing.

Show »
Length:240
Mass (Da):28,122
Checksum:iF4465F15BF7C52E4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MQZ1A0A0A0MQZ1_HUMAN
Corticotropin-releasing factor rece...
CRHR1
430Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3TIK8B3TIK8_HUMAN
CRF1 receptor isoform I variant B
CRHR1
314Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J9JIC6J9JIC6_HUMAN
Corticotropin-releasing factor rece...
CRHR1
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K9J956K9J956_HUMAN
CRH receptor 1 variant B
CRHR1
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JM19A0A0G2JM19_HUMAN
Corticotropin-releasing factor rece...
CRHR1
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSM0J3KSM0_HUMAN
Corticotropin-releasing factor rece...
CRHR1
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QKP8J3QKP8_HUMAN
Corticotropin-releasing factor rece...
CRHR1
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QQR1J3QQR1_HUMAN
Corticotropin-releasing factor rece...
CRHR1
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YFR5H0YFR5_HUMAN
Corticotropin-releasing factor rece...
CRHR1
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0454341 – 204Missing in isoform 5. 2 PublicationsAdd BLAST204
Alternative sequenceiVSP_00199641 – 81GLQCN…YNTTN → D in isoform CRF-R3. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_001997146 – 174Missing in isoform CRF-R2, isoform CRF-R3 and isoform CRF-R4. 7 PublicationsAdd BLAST29
Alternative sequenceiVSP_001998385 – 398Missing in isoform CRF-R4. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L23333 mRNA Translation: AAA35719.1
L23332 mRNA Translation: AAA35718.1
X72304 mRNA Translation: CAA51052.1
AF039523 AF039522 Genomic DNA Translation: AAC69993.1
U16273 mRNA Translation: AAC50073.1
AF180301 mRNA Translation: AAD52688.1
FJ543100 mRNA Translation: ACU68591.1
AY457172 mRNA Translation: AAR19768.1
AB451466 mRNA Translation: BAG70280.1
AK295559 mRNA Translation: BAG58461.1
AC126544 Genomic DNA No translation available.
AC217770 Genomic DNA No translation available.
AC217771 Genomic DNA No translation available.
AC217774 Genomic DNA No translation available.
AC225613 Genomic DNA No translation available.
CH471233 Genomic DNA Translation: EAW93557.1
BC096836 mRNA Translation: AAH96836.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS42350.1 [P34998-2]
CCDS45712.1 [P34998-1]
CCDS45713.1 [P34998-4]
CCDS45714.1 [P34998-3]
CCDS58556.1 [P34998-5]

Protein sequence database of the Protein Information Resource

More...PIRi		I38879
I60975 A48260

NCBI Reference Sequences

More...RefSeqi		NP_001138618.1, NM_001145146.1 [P34998-1]
NP_001138619.1, NM_001145147.1 [P34998-3]
NP_001138620.1, NM_001145148.1 [P34998-4]
NP_001243228.1, NM_001256299.2 [P34998-5]
NP_001289945.1, NM_001303016.1
NP_001289947.1, NM_001303018.1 [P34998-5]
NP_004373.2, NM_004382.4 [P34998-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000314537; ENSP00000326060; ENSG00000120088 [P34998-2]
ENST00000352855; ENSP00000344068; ENSG00000120088 [P34998-3]
ENST00000398285; ENSP00000381333; ENSG00000120088 [P34998-1]
ENST00000577353; ENSP00000462016; ENSG00000120088 [P34998-4]
ENST00000616274; ENSP00000480396; ENSG00000276191 [P34998-1]
ENST00000616748; ENSP00000478177; ENSG00000276191 [P34998-3]
ENST00000617905; ENSP00000483802; ENSG00000276191 [P34998-2]
ENST00000633723; ENSP00000488342; ENSG00000276191 [P34998-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		104909134
1394

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:104909134
hsa:1394

UCSC genome browser

More...UCSCi		uc002ijm.4 human [P34998-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L23333 mRNA Translation: AAA35719.1
L23332 mRNA Translation: AAA35718.1
X72304 mRNA Translation: CAA51052.1
AF039523 AF039522 Genomic DNA Translation: AAC69993.1
U16273 mRNA Translation: AAC50073.1
AF180301 mRNA Translation: AAD52688.1
FJ543100 mRNA Translation: ACU68591.1
AY457172 mRNA Translation: AAR19768.1
AB451466 mRNA Translation: BAG70280.1
AK295559 mRNA Translation: BAG58461.1
AC126544 Genomic DNA No translation available.
AC217770 Genomic DNA No translation available.
AC217771 Genomic DNA No translation available.
AC217774 Genomic DNA No translation available.
AC225613 Genomic DNA No translation available.
CH471233 Genomic DNA Translation: EAW93557.1
BC096836 mRNA Translation: AAH96836.1
CCDSiCCDS42350.1 [P34998-2]
CCDS45712.1 [P34998-1]
CCDS45713.1 [P34998-4]
CCDS45714.1 [P34998-3]
CCDS58556.1 [P34998-5]
PIRiI38879
I60975 A48260
RefSeqiNP_001138618.1, NM_001145146.1 [P34998-1]
NP_001138619.1, NM_001145147.1 [P34998-3]
NP_001138620.1, NM_001145148.1 [P34998-4]
NP_001243228.1, NM_001256299.2 [P34998-5]
NP_001289945.1, NM_001303016.1
NP_001289947.1, NM_001303018.1 [P34998-5]
NP_004373.2, NM_004382.4 [P34998-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L27NMR-A25-108[»]
3EHSX-ray2.76A24-119[»]
3EHTX-ray3.40A24-119[»]
3EHUX-ray1.96A/B24-119[»]
4K5YX-ray2.98A/B/C104-373[»]
4Z9GX-ray3.18A/B/C104-249[»]
A/B/C252-401[»]
6P9Xelectron microscopy2.91R23-444[»]
6PB0electron microscopy3.00R24-427[»]
SMRiP34998
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107784, 18 interactors
IntActiP34998, 7 interactors
MINTiP34998
STRINGi9606.ENSP00000381333

Chemistry databases

BindingDBiP34998
ChEMBLiCHEMBL1800
DrugBankiDB09067 Corticorelin ovine triflutate
DrugCentraliP34998
GuidetoPHARMACOLOGYi212

Protein family/group databases

TCDBi9.A.14.4.3 the g-protein-coupled receptor (gpcr) family

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

iPTMnetiP34998
PhosphoSitePlusiP34998

Polymorphism and mutation databases

BioMutaiCRHR1
DMDMi461836

Proteomic databases

PaxDbiP34998
PeptideAtlasiP34998
PRIDEiP34998
ProteomicsDBi4300
54968 [P34998-1]
54969 [P34998-2]
54970 [P34998-3]
54971 [P34998-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		8417 376 antibodies

The DNASU plasmid repository

More...DNASUi		1394

Genome annotation databases

EnsembliENST00000314537; ENSP00000326060; ENSG00000120088 [P34998-2]
ENST00000352855; ENSP00000344068; ENSG00000120088 [P34998-3]
ENST00000398285; ENSP00000381333; ENSG00000120088 [P34998-1]
ENST00000577353; ENSP00000462016; ENSG00000120088 [P34998-4]
ENST00000616274; ENSP00000480396; ENSG00000276191 [P34998-1]
ENST00000616748; ENSP00000478177; ENSG00000276191 [P34998-3]
ENST00000617905; ENSP00000483802; ENSG00000276191 [P34998-2]
ENST00000633723; ENSP00000488342; ENSG00000276191 [P34998-4]
GeneIDi104909134
1394
KEGGihsa:104909134
hsa:1394
UCSCiuc002ijm.4 human [P34998-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		104909134
1394
DisGeNETi104909134
1394
EuPathDBiHostDB:ENSG00000120088.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		CRHR1
HGNCiHGNC:2357 CRHR1
HPAiENSG00000120088 Group enriched (brain, pituitary gland)
MIMi122561 gene
neXtProtiNX_P34998
OpenTargetsiENSG00000120088
ENSG00000263715
PharmGKBiPA26874

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4564 Eukaryota
ENOG410XRS2 LUCA
GeneTreeiENSGT00940000158410
InParanoidiP34998
KOiK04578
OMAiVHYHIAV
OrthoDBi1163977at2759
PhylomeDBiP34998
TreeFamiTF315710

Enzyme and pathway databases

ReactomeiR-HSA-373080 Class B/2 (Secretin family receptors)
R-HSA-418555 G alpha (s) signalling events
SIGNORiP34998

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		104909134 0 hits in 3 CRISPR screens
1394 2 hits in 781 CRISPR screens
EvolutionaryTraceiP34998

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Corticotropin_releasing_hormone_receptor_1
PharosiP34998 Tclin

Protein Ontology

More...PROi		PR:P34998
RNActiP34998 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000120088 Expressed in pituitary gland and 62 other tissues
ExpressionAtlasiP34998 baseline and differential
GenevisibleiP34998 HS

Family and domain databases

Gene3Di4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR017981 GPCR_2-like
IPR003052 GPCR_2_CRF1_rcpt
IPR003051 GPCR_2_CRF_rcpt
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF02793 HRM, 1 hit
PRINTSiPR01279 CRFRECEPTOR
PR01280 CRFRECEPTOR1
PR00249 GPCRSECRETIN
SMARTiView protein in SMART
SM00008 HormR, 1 hit
SUPFAMiSSF111418 SSF111418, 1 hit
PROSITEiView protein in PROSITE
PS00649 G_PROTEIN_RECEP_F2_1, 1 hit
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCRFR1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P34998
Secondary accession number(s): B4DIE9
, Q13008, Q4QRJ1, Q9UK64
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: June 17, 2020
This is version 202 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  5. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again