Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P34969 (5HT7R_HUMAN)

Protein

5-hydroxytryptamine receptor 7

Gene

HTR7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-390666 Serotonin receptors
R-HSA-418555 G alpha (s) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
5-hydroxytryptamine receptor 7
Short name:
5-HT-7
Short name:
5-HT7
Alternative name(s):
5-HT-X
Serotonin receptor 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HTR7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000148680.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:5302 HTR7

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		182137 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P34969

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 83ExtracellularBy similarityAdd BLAST83
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei84 – 104Helical; Name=1By similarityAdd BLAST21
Topological domaini105 – 117CytoplasmicBy similarityAdd BLAST13
Transmembranei118 – 138Helical; Name=2By similarityAdd BLAST21
Topological domaini139 – 157ExtracellularBy similarityAdd BLAST19
Transmembranei158 – 178Helical; Name=3By similarityAdd BLAST21
Topological domaini179 – 201CytoplasmicBy similarityAdd BLAST23
Transmembranei202 – 222Helical; Name=4By similarityAdd BLAST21
Topological domaini223 – 236ExtracellularBy similarityAdd BLAST14
Transmembranei237 – 257Helical; Name=5By similarityAdd BLAST21
Topological domaini258 – 325CytoplasmicBy similarityAdd BLAST68
Transmembranei326 – 346Helical; Name=6By similarityAdd BLAST21
Topological domaini347 – 367ExtracellularBy similarityAdd BLAST21
Transmembranei368 – 388Helical; Name=7By similarityAdd BLAST21
Topological domaini389 – 479CytoplasmicBy similarityAdd BLAST91

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		3363

Open Targets

More...OpenTargetsi		ENSG00000148680

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29561

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3155

Drug and drug target database

More...DrugBanki		DB06288 Amisulpride
DB00321 Amitriptyline
DB00543 Amoxapine
DB01238 Aripiprazole
DB06216 Asenapine
DB01200 Bromocriptine
DB00248 Cabergoline
DB00477 Chlorpromazine
DB00363 Clozapine
DB00988 Dopamine
DB00216 Eletriptan
DB00751 Epinastine
DB01049 Ergoloid mesylate
DB04946 Iloperidone
DB00458 Imipramine
DB00408 Loxapine
DB08815 Lurasidone
DB00934 Maprotiline
DB00247 Methysergide
DB06148 Mianserin
DB00370 Mirtazapine
DB00334 Olanzapine
DB01224 Quetiapine
DB13025 Tiapride
DB09068 Vortioxetine
DB00246 Ziprasidone

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		12

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HTR7

Domain mapping of disease mutations (DMDM)

More...DMDMi		8488960

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000689791 – 4795-hydroxytryptamine receptor 7Add BLAST479

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi5N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi66N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi155 ↔ 231PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi401S-palmitoyl cysteineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P34969

PRoteomics IDEntifications database

More...PRIDEi		P34969

ProteomicsDB human proteome resource

More...ProteomicsDBi		54961
54962 [P34969-2]
54963 [P34969-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P34969

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P34969

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform A is the predominant isoform in spleen, caudate and hippocampus. Isoform B is expressed at lower levels. Isoform D is a minor isoform in terms of expression.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000148680 Expressed in 137 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...CleanExi		HS_HTR7

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P34969 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB022708
HPA073617

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		109595, 4 interactors

Protein interaction database and analysis system

More...IntActi		P34969, 77 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000337949

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P34969

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P34969

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3656 Eukaryota
ENOG410XRW9 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153360

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG106962

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P34969

KEGG Orthology (KO)

More...KOi		K04163

Identification of Orthologs from Complete Genome Data

More...OMAi		QCRYRNI

Database of Orthologous Groups

More...OrthoDBi		EOG091G06VI

Database for complete collections of gene phylogenies

More...PhylomeDBi		P34969

TreeFam database of animal gene trees

More...TreeFami		TF331895

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001069 5HT_7_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00652 5HT7RECEPTR
PR00237 GPCRRHODOPSN

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Isoform A and isoform B appear to be expressed at higher levels.
Isoform D (identifier: P34969-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMDVNSSGRP DLYGHLRSFL LPEVGRGLPD LSPDGGADPV AGSWAPHLLS 
        60         70         80         90        100
EVTASPAPTW DAPPDNASGC GEQINYGRVE KVVIGSILTL ITLLTIAGNC 
       110        120        130        140        150
LVVISVCFVK KLRQPSNYLI VSLALADLSV AVAVMPFVSV TDLIGGKWIF 
       160        170        180        190        200
GHFFCNVFIA MDVMCCTASI MTLCVISIDR YLGITRPLTY PVRQNGKCMA 
       210        220        230        240        250
KMILSVWLLS ASITLPPLFG WAQNVNDDKV CLISQDFGYT IYSTAVAFYI 
       260        270        280        290        300
PMSVMLFMYY QIYKAARKSA AKHKFPGFPR VEPDSVIALN GIVKLQKEVE 
       310        320        330        340        350
ECANLSRLLK HERKNISIFK REQKAATTLG IIVGAFTVCW LPFFLLSTAR 
       360        370        380        390        400
PFICGTSCSC IPLWVERTFL WLGYANSLIN PFIYAFFNRD LRTTYRSLLQ 
       410        420        430        440        450
CQYRNINRKL SAAGMHEALK LAERPERPEF VLRACTRRVL LRPEKRPPVS 
       460        470 
VWVLQSPDHH NWLADKMLTT VEKKVMIHD
Length:479
Mass (Da):53,555
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1F62E985EADE1F23
GO
Isoform A (identifier: P34969-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: RACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD → QNADYCRKKGHDS

Show »
Length:445
Mass (Da):49,488
Checksum:iA09BE5E3CBCAB232
GO
Isoform B (identifier: P34969-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: Missing.

Show »
Length:432
Mass (Da):47,984
Checksum:iD6202D8C921D627E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01299592T → K1 Publication1
Natural variantiVAR_012996279P → L1 PublicationCorresponds to variant dbSNP:rs114969659Ensembl.1
Natural variantiVAR_049365448P → Q. Corresponds to variant dbSNP:rs33954285Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001857433 – 479RACTR…VMIHD → QNADYCRKKGHDS in isoform A. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_001856433 – 479Missing in isoform B. 2 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U68487 mRNA Translation: AAB48393.1
U68488 mRNA Translation: AAB48394.1
U68492 Genomic DNA Translation: AAF07218.1
U68493, U68492 Genomic DNA Translation: AAF07217.1
U68493, U68492 Genomic DNA Translation: AAB48397.2
L21195 mRNA Translation: AAC37538.1
AY493988 mRNA Translation: AAR87480.1
AK292606 mRNA Translation: BAF85295.1
AB451482 mRNA Translation: BAG70296.1
AL360011 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50118.1
CH471066 Genomic DNA Translation: EAW50119.1
CH471066 Genomic DNA Translation: EAW50120.1
BC047526 mRNA Translation: AAH47526.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS7408.1 [P34969-1]
CCDS7409.1 [P34969-2]
CCDS7410.1 [P34969-3]

Protein sequence database of the Protein Information Resource

More...PIRi		A48881

NCBI Reference Sequences

More...RefSeqi		NP_000863.1, NM_000872.4 [P34969-2]
NP_062873.1, NM_019859.3 [P34969-1]
NP_062874.1, NM_019860.3 [P34969-3]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.73739

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000277874; ENSP00000277874; ENSG00000148680 [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680 [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680 [P34969-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		3363

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:3363

UCSC genome browser

More...UCSCi		uc001kgz.4 human [P34969-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68487 mRNA Translation: AAB48393.1
U68488 mRNA Translation: AAB48394.1
U68492 Genomic DNA Translation: AAF07218.1
U68493, U68492 Genomic DNA Translation: AAF07217.1
U68493, U68492 Genomic DNA Translation: AAB48397.2
L21195 mRNA Translation: AAC37538.1
AY493988 mRNA Translation: AAR87480.1
AK292606 mRNA Translation: BAF85295.1
AB451482 mRNA Translation: BAG70296.1
AL360011 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50118.1
CH471066 Genomic DNA Translation: EAW50119.1
CH471066 Genomic DNA Translation: EAW50120.1
BC047526 mRNA Translation: AAH47526.1
CCDSiCCDS7408.1 [P34969-1]
CCDS7409.1 [P34969-2]
CCDS7410.1 [P34969-3]
PIRiA48881
RefSeqiNP_000863.1, NM_000872.4 [P34969-2]
NP_062873.1, NM_019859.3 [P34969-1]
NP_062874.1, NM_019860.3 [P34969-3]
UniGeneiHs.73739

3D structure databases

ProteinModelPortaliP34969
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109595, 4 interactors
IntActiP34969, 77 interactors
STRINGi9606.ENSP00000337949

Chemistry databases

BindingDBiP34969
ChEMBLiCHEMBL3155
DrugBankiDB06288 Amisulpride
DB00321 Amitriptyline
DB00543 Amoxapine
DB01238 Aripiprazole
DB06216 Asenapine
DB01200 Bromocriptine
DB00248 Cabergoline
DB00477 Chlorpromazine
DB00363 Clozapine
DB00988 Dopamine
DB00216 Eletriptan
DB00751 Epinastine
DB01049 Ergoloid mesylate
DB04946 Iloperidone
DB00458 Imipramine
DB00408 Loxapine
DB08815 Lurasidone
DB00934 Maprotiline
DB00247 Methysergide
DB06148 Mianserin
DB00370 Mirtazapine
DB00334 Olanzapine
DB01224 Quetiapine
DB13025 Tiapride
DB09068 Vortioxetine
DB00246 Ziprasidone
GuidetoPHARMACOLOGYi12

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

iPTMnetiP34969
PhosphoSitePlusiP34969

Polymorphism and mutation databases

BioMutaiHTR7
DMDMi8488960

Proteomic databases

PaxDbiP34969
PRIDEiP34969
ProteomicsDBi54961
54962 [P34969-2]
54963 [P34969-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277874; ENSP00000277874; ENSG00000148680 [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680 [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680 [P34969-3]
GeneIDi3363
KEGGihsa:3363
UCSCiuc001kgz.4 human [P34969-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3363
DisGeNETi3363
EuPathDBiHostDB:ENSG00000148680.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		HTR7
HGNCiHGNC:5302 HTR7
HPAiCAB022708
HPA073617
MIMi182137 gene
neXtProtiNX_P34969
OpenTargetsiENSG00000148680
PharmGKBiPA29561

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00940000153360
HOVERGENiHBG106962
InParanoidiP34969
KOiK04163
OMAiQCRYRNI
OrthoDBiEOG091G06VI
PhylomeDBiP34969
TreeFamiTF331895

Enzyme and pathway databases

ReactomeiR-HSA-390666 Serotonin receptors
R-HSA-418555 G alpha (s) signalling events

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		5-HT7_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		3363

Protein Ontology

More...PROi		PR:P34969

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000148680 Expressed in 137 organ(s), highest expression level in testis
CleanExiHS_HTR7
GenevisibleiP34969 HS

Family and domain databases

InterProiView protein in InterPro
IPR001069 5HT_7_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00652 5HT7RECEPTR
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei5HT7R_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P34969
Secondary accession number(s): B5BUP6
, P78336, P78372, P78516, Q5VX01, Q5VX02, Q5VX03
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: May 30, 2000
Last modified: December 5, 2018
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again