Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 7

Gene

HTR7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-390666 Serotonin receptors
R-HSA-418555 G alpha (s) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 7
Short name:
5-HT-7
Short name:
5-HT7
Alternative name(s):
5-HT-X
Serotonin receptor 7
Gene namesi
Name:HTR7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000148680.15
HGNCiHGNC:5302 HTR7
MIMi182137 gene
neXtProtiNX_P34969

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 83ExtracellularBy similarityAdd BLAST83
Transmembranei84 – 104Helical; Name=1By similarityAdd BLAST21
Topological domaini105 – 117CytoplasmicBy similarityAdd BLAST13
Transmembranei118 – 138Helical; Name=2By similarityAdd BLAST21
Topological domaini139 – 157ExtracellularBy similarityAdd BLAST19
Transmembranei158 – 178Helical; Name=3By similarityAdd BLAST21
Topological domaini179 – 201CytoplasmicBy similarityAdd BLAST23
Transmembranei202 – 222Helical; Name=4By similarityAdd BLAST21
Topological domaini223 – 236ExtracellularBy similarityAdd BLAST14
Transmembranei237 – 257Helical; Name=5By similarityAdd BLAST21
Topological domaini258 – 325CytoplasmicBy similarityAdd BLAST68
Transmembranei326 – 346Helical; Name=6By similarityAdd BLAST21
Topological domaini347 – 367ExtracellularBy similarityAdd BLAST21
Transmembranei368 – 388Helical; Name=7By similarityAdd BLAST21
Topological domaini389 – 479CytoplasmicBy similarityAdd BLAST91

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3363
OpenTargetsiENSG00000148680
PharmGKBiPA29561

Chemistry databases

ChEMBLiCHEMBL3155
DrugBankiDB06288 Amisulpride
DB00321 Amitriptyline
DB00543 Amoxapine
DB01238 Aripiprazole
DB06216 Asenapine
DB01200 Bromocriptine
DB00248 Cabergoline
DB00477 Chlorpromazine
DB00363 Clozapine
DB00988 Dopamine
DB00216 Eletriptan
DB00751 Epinastine
DB01049 Ergoloid mesylate
DB04946 Iloperidone
DB00458 Imipramine
DB00408 Loxapine
DB08815 Lurasidone
DB00934 Maprotiline
DB00247 Methysergide
DB06148 Mianserin
DB00370 Mirtazapine
DB00334 Olanzapine
DB01224 Quetiapine
DB13025 Tiapride
DB09068 Vortioxetine
DB00246 Ziprasidone
GuidetoPHARMACOLOGYi12

Polymorphism and mutation databases

BioMutaiHTR7
DMDMi8488960

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000689791 – 4795-hydroxytryptamine receptor 7Add BLAST479

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi5N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi66N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi155 ↔ 231PROSITE-ProRule annotation
Lipidationi401S-palmitoyl cysteineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP34969
PRIDEiP34969
ProteomicsDBi54961
54962 [P34969-2]
54963 [P34969-3]

PTM databases

iPTMnetiP34969
PhosphoSitePlusiP34969

Expressioni

Tissue specificityi

Isoform A is the predominant isoform in spleen, caudate and hippocampus. Isoform B is expressed at lower levels. Isoform D is a minor isoform in terms of expression.1 Publication

Gene expression databases

BgeeiENSG00000148680 Expressed in 137 organ(s), highest expression level in testis
CleanExiHS_HTR7
GenevisibleiP34969 HS

Organism-specific databases

HPAiCAB022708
HPA073617

Interactioni

Protein-protein interaction databases

BioGridi109595, 4 interactors
IntActiP34969, 77 interactors
STRINGi9606.ENSP00000337949

Chemistry databases

BindingDBiP34969

Structurei

3D structure databases

ProteinModelPortaliP34969
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00760000118795
HOVERGENiHBG106962
InParanoidiP34969
KOiK04163
OMAiQCRYRNI
OrthoDBiEOG091G06VI
PhylomeDBiP34969
TreeFamiTF331895

Family and domain databases

InterProiView protein in InterPro
IPR001069 5HT_7_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00652 5HT7RECEPTR
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Isoform A and isoform B appear to be expressed at higher levels.
Isoform D (identifier: P34969-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMDVNSSGRP DLYGHLRSFL LPEVGRGLPD LSPDGGADPV AGSWAPHLLS
60 70 80 90 100
EVTASPAPTW DAPPDNASGC GEQINYGRVE KVVIGSILTL ITLLTIAGNC
110 120 130 140 150
LVVISVCFVK KLRQPSNYLI VSLALADLSV AVAVMPFVSV TDLIGGKWIF
160 170 180 190 200
GHFFCNVFIA MDVMCCTASI MTLCVISIDR YLGITRPLTY PVRQNGKCMA
210 220 230 240 250
KMILSVWLLS ASITLPPLFG WAQNVNDDKV CLISQDFGYT IYSTAVAFYI
260 270 280 290 300
PMSVMLFMYY QIYKAARKSA AKHKFPGFPR VEPDSVIALN GIVKLQKEVE
310 320 330 340 350
ECANLSRLLK HERKNISIFK REQKAATTLG IIVGAFTVCW LPFFLLSTAR
360 370 380 390 400
PFICGTSCSC IPLWVERTFL WLGYANSLIN PFIYAFFNRD LRTTYRSLLQ
410 420 430 440 450
CQYRNINRKL SAAGMHEALK LAERPERPEF VLRACTRRVL LRPEKRPPVS
460 470
VWVLQSPDHH NWLADKMLTT VEKKVMIHD
Length:479
Mass (Da):53,555
Last modified:May 30, 2000 - v2
Checksum:i1F62E985EADE1F23
GO
Isoform A (identifier: P34969-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: RACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD → QNADYCRKKGHDS

Show »
Length:445
Mass (Da):49,488
Checksum:iA09BE5E3CBCAB232
GO
Isoform B (identifier: P34969-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-479: Missing.

Show »
Length:432
Mass (Da):47,984
Checksum:iD6202D8C921D627E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01299592T → K1 Publication1
Natural variantiVAR_012996279P → L1 PublicationCorresponds to variant dbSNP:rs114969659Ensembl.1
Natural variantiVAR_049365448P → Q. Corresponds to variant dbSNP:rs33954285Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001857433 – 479RACTR…VMIHD → QNADYCRKKGHDS in isoform A. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_001856433 – 479Missing in isoform B. 2 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68487 mRNA Translation: AAB48393.1
U68488 mRNA Translation: AAB48394.1
U68492 Genomic DNA Translation: AAF07218.1
U68493, U68492 Genomic DNA Translation: AAF07217.1
U68493, U68492 Genomic DNA Translation: AAB48397.2
L21195 mRNA Translation: AAC37538.1
AY493988 mRNA Translation: AAR87480.1
AK292606 mRNA Translation: BAF85295.1
AB451482 mRNA Translation: BAG70296.1
AL360011 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50118.1
CH471066 Genomic DNA Translation: EAW50119.1
CH471066 Genomic DNA Translation: EAW50120.1
BC047526 mRNA Translation: AAH47526.1
CCDSiCCDS7408.1 [P34969-1]
CCDS7409.1 [P34969-2]
CCDS7410.1 [P34969-3]
PIRiA48881
RefSeqiNP_000863.1, NM_000872.4 [P34969-2]
NP_062873.1, NM_019859.3 [P34969-1]
NP_062874.1, NM_019860.3 [P34969-3]
UniGeneiHs.73739

Genome annotation databases

EnsembliENST00000277874; ENSP00000277874; ENSG00000148680 [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680 [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680 [P34969-3]
GeneIDi3363
KEGGihsa:3363
UCSCiuc001kgz.4 human [P34969-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68487 mRNA Translation: AAB48393.1
U68488 mRNA Translation: AAB48394.1
U68492 Genomic DNA Translation: AAF07218.1
U68493, U68492 Genomic DNA Translation: AAF07217.1
U68493, U68492 Genomic DNA Translation: AAB48397.2
L21195 mRNA Translation: AAC37538.1
AY493988 mRNA Translation: AAR87480.1
AK292606 mRNA Translation: BAF85295.1
AB451482 mRNA Translation: BAG70296.1
AL360011 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50118.1
CH471066 Genomic DNA Translation: EAW50119.1
CH471066 Genomic DNA Translation: EAW50120.1
BC047526 mRNA Translation: AAH47526.1
CCDSiCCDS7408.1 [P34969-1]
CCDS7409.1 [P34969-2]
CCDS7410.1 [P34969-3]
PIRiA48881
RefSeqiNP_000863.1, NM_000872.4 [P34969-2]
NP_062873.1, NM_019859.3 [P34969-1]
NP_062874.1, NM_019860.3 [P34969-3]
UniGeneiHs.73739

3D structure databases

ProteinModelPortaliP34969
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109595, 4 interactors
IntActiP34969, 77 interactors
STRINGi9606.ENSP00000337949

Chemistry databases

BindingDBiP34969
ChEMBLiCHEMBL3155
DrugBankiDB06288 Amisulpride
DB00321 Amitriptyline
DB00543 Amoxapine
DB01238 Aripiprazole
DB06216 Asenapine
DB01200 Bromocriptine
DB00248 Cabergoline
DB00477 Chlorpromazine
DB00363 Clozapine
DB00988 Dopamine
DB00216 Eletriptan
DB00751 Epinastine
DB01049 Ergoloid mesylate
DB04946 Iloperidone
DB00458 Imipramine
DB00408 Loxapine
DB08815 Lurasidone
DB00934 Maprotiline
DB00247 Methysergide
DB06148 Mianserin
DB00370 Mirtazapine
DB00334 Olanzapine
DB01224 Quetiapine
DB13025 Tiapride
DB09068 Vortioxetine
DB00246 Ziprasidone
GuidetoPHARMACOLOGYi12

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP34969
PhosphoSitePlusiP34969

Polymorphism and mutation databases

BioMutaiHTR7
DMDMi8488960

Proteomic databases

PaxDbiP34969
PRIDEiP34969
ProteomicsDBi54961
54962 [P34969-2]
54963 [P34969-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277874; ENSP00000277874; ENSG00000148680 [P34969-2]
ENST00000336152; ENSP00000337949; ENSG00000148680 [P34969-1]
ENST00000371719; ENSP00000360784; ENSG00000148680 [P34969-3]
GeneIDi3363
KEGGihsa:3363
UCSCiuc001kgz.4 human [P34969-1]

Organism-specific databases

CTDi3363
DisGeNETi3363
EuPathDBiHostDB:ENSG00000148680.15
GeneCardsiHTR7
HGNCiHGNC:5302 HTR7
HPAiCAB022708
HPA073617
MIMi182137 gene
neXtProtiNX_P34969
OpenTargetsiENSG00000148680
PharmGKBiPA29561
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00760000118795
HOVERGENiHBG106962
InParanoidiP34969
KOiK04163
OMAiQCRYRNI
OrthoDBiEOG091G06VI
PhylomeDBiP34969
TreeFamiTF331895

Enzyme and pathway databases

ReactomeiR-HSA-390666 Serotonin receptors
R-HSA-418555 G alpha (s) signalling events

Miscellaneous databases

GeneWikii5-HT7_receptor
GenomeRNAii3363
PROiPR:P34969
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148680 Expressed in 137 organ(s), highest expression level in testis
CleanExiHS_HTR7
GenevisibleiP34969 HS

Family and domain databases

InterProiView protein in InterPro
IPR001069 5HT_7_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00652 5HT7RECEPTR
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry namei5HT7R_HUMAN
AccessioniPrimary (citable) accession number: P34969
Secondary accession number(s): B5BUP6
, P78336, P78372, P78516, Q5VX01, Q5VX02, Q5VX03
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: May 30, 2000
Last modified: November 7, 2018
This is version 171 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  6. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again