Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 180 (02 Jun 2021)
Sequence version 2 (02 Aug 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Transmembrane cell adhesion receptor mua-3

Gene

mua-3

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in cell adhesion and required for organ positioning and attachment (PubMed:25917920, PubMed:11470827, PubMed:11470828).

At the hypodermal surface, required for attachment of the hypdermermis to the basal cuticle in postembryonic development, possibly through intermediate filaments of the cytoskeleton (PubMed:11470828).

3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell-matrix adhesion Source: WormBase

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processCell adhesion

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane cell adhesion receptor mua-3
Alternative name(s):
Muscle attachment abnormal protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:mua-3Imported
ORF Names:K08E5.3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome III

Organism-specific databases

WormBase

More...
WormBasei
K08E5.3a ; CE28049 ; WBGene00003482 ; mua-3
K08E5.3b ; CE37256 ; WBGene00003482 ; mua-3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini25 – 3417ExtracellularSequence analysisAdd BLAST3393
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei3418 – 3438HelicalSequence analysisAdd BLAST21
Topological domaini3439 – 3767CytoplasmicSequence analysisAdd BLAST329

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown results in detached dorsal muscles and retracted ventral muscles from the anterior and posterior ends of the worm.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000766225 – 3767Transmembrane cell adhesion receptor mua-3Add BLAST3743

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi27 ↔ 41PROSITE-ProRule annotation
Disulfide bondi35 ↔ 54PROSITE-ProRule annotation
Disulfide bondi62 ↔ 76PROSITE-ProRule annotation
Disulfide bondi69 ↔ 89PROSITE-ProRule annotation
Disulfide bondi97 ↔ 110PROSITE-ProRule annotation
Disulfide bondi104 ↔ 123PROSITE-ProRule annotation
Disulfide bondi131 ↔ 144PROSITE-ProRule annotation
Disulfide bondi138 ↔ 157PROSITE-ProRule annotation
Disulfide bondi165 ↔ 179PROSITE-ProRule annotation
Disulfide bondi172 ↔ 192PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi201N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi207N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi229 ↔ 243By similarity
Disulfide bondi235 ↔ 252By similarity
Disulfide bondi254 ↔ 267By similarity
Disulfide bondi381 ↔ 392PROSITE-ProRule annotation
Glycosylationi383N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi386 ↔ 402PROSITE-ProRule annotation
Disulfide bondi404 ↔ 415PROSITE-ProRule annotation
Disulfide bondi422 ↔ 435PROSITE-ProRule annotation
Disulfide bondi429 ↔ 444PROSITE-ProRule annotation
Disulfide bondi446 ↔ 465By similarity
Disulfide bondi472 ↔ 486PROSITE-ProRule annotation
Disulfide bondi480 ↔ 495PROSITE-ProRule annotation
Disulfide bondi497 ↔ 516By similarity
Glycosylationi515N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi523 ↔ 536PROSITE-ProRule annotation
Disulfide bondi530 ↔ 545PROSITE-ProRule annotation
Disulfide bondi547 ↔ 565By similarity
Disulfide bondi618 ↔ 632PROSITE-ProRule annotation
Disulfide bondi626 ↔ 642PROSITE-ProRule annotation
Disulfide bondi644 ↔ 662By similarity
Disulfide bondi669 ↔ 682PROSITE-ProRule annotation
Disulfide bondi676 ↔ 691PROSITE-ProRule annotation
Disulfide bondi693 ↔ 712By similarity
Disulfide bondi718 ↔ 729PROSITE-ProRule annotation
Disulfide bondi723 ↔ 738PROSITE-ProRule annotation
Disulfide bondi740 ↔ 759By similarity
Disulfide bondi766 ↔ 779PROSITE-ProRule annotation
Disulfide bondi773 ↔ 788PROSITE-ProRule annotation
Disulfide bondi790 ↔ 809By similarity
Disulfide bondi820 ↔ 836By similarity
Disulfide bondi828 ↔ 845By similarity
Disulfide bondi847 ↔ 859By similarity
Disulfide bondi865 ↔ 879PROSITE-ProRule annotation
Disulfide bondi873 ↔ 888PROSITE-ProRule annotation
Disulfide bondi890 ↔ 907By similarity
Disulfide bondi914 ↔ 930PROSITE-ProRule annotation
Disulfide bondi924 ↔ 939PROSITE-ProRule annotation
Disulfide bondi941 ↔ 960By similarity
Disulfide bondi967 ↔ 981PROSITE-ProRule annotation
Disulfide bondi975 ↔ 990PROSITE-ProRule annotation
Disulfide bondi992 ↔ 1011By similarity
Disulfide bondi1033 ↔ 1046By similarity
Disulfide bondi1040 ↔ 1055By similarity
Disulfide bondi1057 ↔ 1069By similarity
Disulfide bondi1075 ↔ 1087PROSITE-ProRule annotation
Disulfide bondi1081 ↔ 1096PROSITE-ProRule annotation
Disulfide bondi1098 ↔ 1117By similarity
Disulfide bondi1124 ↔ 1137PROSITE-ProRule annotation
Disulfide bondi1131 ↔ 1146PROSITE-ProRule annotation
Disulfide bondi1148 ↔ 1167By similarity
Disulfide bondi1174 ↔ 1188PROSITE-ProRule annotation
Disulfide bondi1182 ↔ 1197PROSITE-ProRule annotation
Disulfide bondi1199 ↔ 1218By similarity
Glycosylationi1350N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi1425 ↔ 1441By similarity
Disulfide bondi1433 ↔ 1450By similarity
Disulfide bondi1452 ↔ 1465By similarity
Disulfide bondi1470 ↔ 1484By similarity
Disulfide bondi1478 ↔ 1494By similarity
Disulfide bondi1496 ↔ 1509By similarity
Disulfide bondi1525 ↔ 1538By similarity
Disulfide bondi1532 ↔ 1547By similarity
Disulfide bondi1549 ↔ 1561By similarity
Disulfide bondi1567 ↔ 1583By similarity
Disulfide bondi1575 ↔ 1592By similarity
Disulfide bondi1594 ↔ 1607By similarity
Disulfide bondi1612 ↔ 1625PROSITE-ProRule annotation
Disulfide bondi1619 ↔ 1634PROSITE-ProRule annotation
Disulfide bondi1636 ↔ 1655By similarity
Disulfide bondi1662 ↔ 1675PROSITE-ProRule annotation
Disulfide bondi1669 ↔ 1684PROSITE-ProRule annotation
Disulfide bondi1686 ↔ 1705By similarity
Disulfide bondi1712 ↔ 1726PROSITE-ProRule annotation
Disulfide bondi1720 ↔ 1735PROSITE-ProRule annotation
Disulfide bondi1737 ↔ 1754PROSITE-ProRule annotation
Disulfide bondi1763 ↔ 1776PROSITE-ProRule annotation
Disulfide bondi1770 ↔ 1786PROSITE-ProRule annotation
Disulfide bondi1788 ↔ 1806By similarity
Disulfide bondi1813 ↔ 1829PROSITE-ProRule annotation
Disulfide bondi1821 ↔ 1838PROSITE-ProRule annotation
Disulfide bondi1840 ↔ 1859By similarity
Disulfide bondi1866 ↔ 1880PROSITE-ProRule annotation
Disulfide bondi1873 ↔ 1889PROSITE-ProRule annotation
Disulfide bondi1891 ↔ 1910By similarity
Disulfide bondi1917 ↔ 1930PROSITE-ProRule annotation
Disulfide bondi1924 ↔ 1939PROSITE-ProRule annotation
Disulfide bondi1941 ↔ 1960By similarity
Disulfide bondi1967 ↔ 1980PROSITE-ProRule annotation
Disulfide bondi1974 ↔ 1989PROSITE-ProRule annotation
Disulfide bondi1991 ↔ 2010By similarity
Disulfide bondi2018 ↔ 2031PROSITE-ProRule annotation
Disulfide bondi2025 ↔ 2040PROSITE-ProRule annotation
Disulfide bondi2042 ↔ 2061By similarity
Disulfide bondi2072 ↔ 2088By similarity
Disulfide bondi2080 ↔ 2097By similarity
Disulfide bondi2099 ↔ 2111By similarity
Disulfide bondi2117 ↔ 2131PROSITE-ProRule annotation
Disulfide bondi2125 ↔ 2140PROSITE-ProRule annotation
Disulfide bondi2142 ↔ 2159By similarity
Disulfide bondi2166 ↔ 2180PROSITE-ProRule annotation
Disulfide bondi2174 ↔ 2189PROSITE-ProRule annotation
Disulfide bondi2191 ↔ 2207By similarity
Disulfide bondi2214 ↔ 2228PROSITE-ProRule annotation
Disulfide bondi2222 ↔ 2237PROSITE-ProRule annotation
Disulfide bondi2239 ↔ 2257By similarity
Disulfide bondi2264 ↔ 2278PROSITE-ProRule annotation
Disulfide bondi2272 ↔ 2287PROSITE-ProRule annotation
Disulfide bondi2289 ↔ 2307PROSITE-ProRule annotation
Disulfide bondi2314 ↔ 2327PROSITE-ProRule annotation
Disulfide bondi2321 ↔ 2336PROSITE-ProRule annotation
Disulfide bondi2338 ↔ 2357By similarity
Disulfide bondi2364 ↔ 2377PROSITE-ProRule annotation
Disulfide bondi2371 ↔ 2386PROSITE-ProRule annotation
Disulfide bondi2388 ↔ 2407By similarity
Disulfide bondi2413 ↔ 2425PROSITE-ProRule annotation
Disulfide bondi2419 ↔ 2435PROSITE-ProRule annotation
Disulfide bondi2437 ↔ 2454By similarity
Disulfide bondi2460 ↔ 2474PROSITE-ProRule annotation
Disulfide bondi2468 ↔ 2483PROSITE-ProRule annotation
Disulfide bondi2485 ↔ 2503By similarity
Disulfide bondi2517 ↔ 2531PROSITE-ProRule annotation
Disulfide bondi2525 ↔ 2541PROSITE-ProRule annotation
Disulfide bondi2543 ↔ 2562By similarity
Disulfide bondi2569 ↔ 2583PROSITE-ProRule annotation
Disulfide bondi2577 ↔ 2594PROSITE-ProRule annotation
Disulfide bondi2596 ↔ 2615By similarity
Disulfide bondi2622 ↔ 2636PROSITE-ProRule annotation
Disulfide bondi2630 ↔ 2645PROSITE-ProRule annotation
Disulfide bondi2647 ↔ 2665By similarity
Disulfide bondi2672 ↔ 2686PROSITE-ProRule annotation
Disulfide bondi2680 ↔ 2695PROSITE-ProRule annotation
Disulfide bondi2697 ↔ 2713By similarity
Disulfide bondi2720 ↔ 2734PROSITE-ProRule annotation
Disulfide bondi2728 ↔ 2743PROSITE-ProRule annotation
Disulfide bondi2745 ↔ 2762By similarity
Disulfide bondi2767 ↔ 2781PROSITE-ProRule annotation
Disulfide bondi2775 ↔ 2790PROSITE-ProRule annotation
Disulfide bondi2792 ↔ 2810By similarity
Disulfide bondi2837 ↔ 2850By similarity
Disulfide bondi2842 ↔ 2856By similarity
Disulfide bondi2858 ↔ 2871By similarity
Glycosylationi2944N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi3013 ↔ 3026By similarity
Disulfide bondi3018 ↔ 3032By similarity
Disulfide bondi3034 ↔ 3047By similarity
Glycosylationi3120N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi3130N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi3180 ↔ 3191PROSITE-ProRule annotation
Disulfide bondi3185 ↔ 3201PROSITE-ProRule annotation
Disulfide bondi3203 ↔ 3219By similarity
Disulfide bondi3228 ↔ 3242PROSITE-ProRule annotation
Disulfide bondi3236 ↔ 3251PROSITE-ProRule annotation
Disulfide bondi3253 ↔ 3271By similarity
Disulfide bondi3276 ↔ 3288PROSITE-ProRule annotation
Disulfide bondi3282 ↔ 3297PROSITE-ProRule annotation
Glycosylationi3285N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi3299 ↔ 3323By similarity
Disulfide bondi3332 ↔ 3345PROSITE-ProRule annotation
Glycosylationi3337N-linked (GlcNAc...) asparagine; atypical1 Publication1
Glycosylationi3338N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi3339 ↔ 3354PROSITE-ProRule annotation
Disulfide bondi3356 ↔ 3372By similarity
Disulfide bondi3377 ↔ 3386PROSITE-ProRule annotation
Disulfide bondi3380 ↔ 3397PROSITE-ProRule annotation
Glycosylationi3394N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi3399 ↔ 3408PROSITE-ProRule annotation
Glycosylationi3414N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P34576

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P34576

PeptideAtlas

More...
PeptideAtlasi
P34576

PRoteomics IDEntifications database

More...
PRIDEi
P34576

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P34576

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the hypodermis at the sites of muscle contact, in striated muscles including body wall muscles, the anal sphincter muscles and the junctions between the anal sphincter muscle and rectal cuticle. Also expressed in non-muscle cells including the excretory duct cell and pore cells.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed from the two-fold stage onwards.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00003482, Expressed in multi-cellular organism and 4 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
41624, 11 interactors

Protein interaction database and analysis system

More...
IntActi
P34576, 2 interactors

STRING: functional protein association networks

More...
STRINGi
6239.K08E5.3a

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P34576

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini26 – 63LDL-receptor class A 1PROSITE-ProRule annotationAdd BLAST38
Domaini96 – 132LDL-receptor class A 2PROSITE-ProRule annotationAdd BLAST37
Domaini133 – 166LDL-receptor class A 3PROSITE-ProRule annotationAdd BLAST34
Domaini167 – 209LDL-receptor class A 4PROSITE-ProRule annotationAdd BLAST43
Domaini225 – 268EGF-like 1PROSITE-ProRule annotationAdd BLAST44
Domaini375 – 416EGF-like 2PROSITE-ProRule annotationAdd BLAST42
Domaini418 – 466EGF-like 3PROSITE-ProRule annotationAdd BLAST49
Domaini468 – 517EGF-like 4PROSITE-ProRule annotationAdd BLAST50
Domaini519 – 566EGF-like 5PROSITE-ProRule annotationAdd BLAST48
Domaini614 – 663EGF-like 6PROSITE-ProRule annotationAdd BLAST50
Domaini665 – 713EGF-like 7PROSITE-ProRule annotationAdd BLAST49
Domaini714 – 760EGF-like 8PROSITE-ProRule annotationAdd BLAST47
Domaini762 – 810EGF-like 9PROSITE-ProRule annotationAdd BLAST49
Domaini816 – 860EGF-like 10PROSITE-ProRule annotationAdd BLAST45
Domaini861 – 908EGF-like 11PROSITE-ProRule annotationAdd BLAST48
Domaini910 – 961EGF-like 12PROSITE-ProRule annotationAdd BLAST52
Domaini963 – 1012EGF-like 13PROSITE-ProRule annotationAdd BLAST50
Domaini1029 – 1070EGF-like 14PROSITE-ProRule annotationAdd BLAST42
Domaini1071 – 1118EGF-like 15PROSITE-ProRule annotationAdd BLAST48
Domaini1120 – 1168EGF-like 16PROSITE-ProRule annotationAdd BLAST49
Domaini1170 – 1219EGF-like 17PROSITE-ProRule annotationAdd BLAST50
Domaini1230 – 1406VWFAPROSITE-ProRule annotationAdd BLAST177
Domaini1421 – 1466EGF-like 18PROSITE-ProRule annotationAdd BLAST46
Domaini1466 – 1510EGF-like 19PROSITE-ProRule annotationAdd BLAST45
Domaini1521 – 1562EGF-like 20PROSITE-ProRule annotationAdd BLAST42
Domaini1563 – 1608EGF-like 21PROSITE-ProRule annotationAdd BLAST46
Domaini1608 – 1656EGF-like 22PROSITE-ProRule annotationAdd BLAST49
Domaini1658 – 1706EGF-like 23PROSITE-ProRule annotationAdd BLAST49
Domaini1708 – 1755EGF-like 24PROSITE-ProRule annotationAdd BLAST48
Domaini1759 – 1807EGF-like 25PROSITE-ProRule annotationAdd BLAST49
Domaini1809 – 1860EGF-like 26PROSITE-ProRule annotationAdd BLAST52
Domaini1862 – 1911EGF-like 27PROSITE-ProRule annotationAdd BLAST50
Domaini1913 – 1961EGF-like 28PROSITE-ProRule annotationAdd BLAST49
Domaini1963 – 2011EGF-like 29PROSITE-ProRule annotationAdd BLAST49
Domaini2014 – 2062EGF-like 30PROSITE-ProRule annotationAdd BLAST49
Domaini2068 – 2112EGF-like 31PROSITE-ProRule annotationAdd BLAST45
Domaini2113 – 2160EGF-like 32PROSITE-ProRule annotationAdd BLAST48
Domaini2162 – 2208EGF-like 33PROSITE-ProRule annotationAdd BLAST47
Domaini2210 – 2258EGF-like 34PROSITE-ProRule annotationAdd BLAST49
Domaini2260 – 2308EGF-like 35PROSITE-ProRule annotationAdd BLAST49
Domaini2310 – 2358EGF-like 36PROSITE-ProRule annotationAdd BLAST49
Domaini2360 – 2408EGF-like 37PROSITE-ProRule annotationAdd BLAST49
Domaini2409 – 2455EGF-like 38PROSITE-ProRule annotationAdd BLAST47
Domaini2456 – 2504EGF-like 39PROSITE-ProRule annotationAdd BLAST49
Domaini2513 – 2563EGF-like 40PROSITE-ProRule annotationAdd BLAST51
Domaini2565 – 2616EGF-like 41PROSITE-ProRule annotationAdd BLAST52
Domaini2618 – 2666EGF-like 42PROSITE-ProRule annotationAdd BLAST49
Domaini2668 – 2714EGF-like 43PROSITE-ProRule annotationAdd BLAST47
Domaini2716 – 2763EGF-like 44PROSITE-ProRule annotationAdd BLAST48
Domaini2763 – 2811EGF-like 45PROSITE-ProRule annotationAdd BLAST49
Domaini2833 – 2872EGF-like 46PROSITE-ProRule annotationAdd BLAST40
Domaini2873 – 2999SEA 1PROSITE-ProRule annotationAdd BLAST127
Domaini3009 – 3048EGF-like 47PROSITE-ProRule annotationAdd BLAST40
Domaini3049 – 3174SEA 2PROSITE-ProRule annotationAdd BLAST126
Domaini3176 – 3220EGF-like 48PROSITE-ProRule annotationAdd BLAST45
Domaini3224 – 3272EGF-like 49PROSITE-ProRule annotationAdd BLAST49
Domaini3272 – 3324EGF-like 50PROSITE-ProRule annotationAdd BLAST53
Domaini3328 – 3373EGF-like 51; calcium-bindingPROSITE-ProRule annotationAdd BLAST46
Domaini3373 – 3409EGF-like 52PROSITE-ProRule annotationAdd BLAST37

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2492 – 2521DisorderedSequence analysisAdd BLAST30
Regioni3582 – 3729DisorderedSequence analysisAdd BLAST148

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi2501 – 2516Pro residuesSequence analysisAdd BLAST16
Compositional biasi3582 – 3601Polar residuesSequence analysisAdd BLAST20
Compositional biasi3608 – 3671Polar residuesSequence analysisAdd BLAST64
Compositional biasi3673 – 3688Basic and acidic residuesSequence analysisAdd BLAST16

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1217, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P34576

Identification of Orthologs from Complete Genome Data

More...
OMAi
LEEGYTC

Database of Orthologous Groups

More...
OrthoDBi
1174178at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P34576

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112, LDLa, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.410, 1 hit
4.10.400.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001881, EGF-like_Ca-bd_dom
IPR013032, EGF-like_CS
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR018097, EGF_Ca-bd_CS
IPR009030, Growth_fac_rcpt_cys_sf
IPR036055, LDL_receptor-like_sf
IPR002172, LDrepeatLR_classA_rpt
IPR000082, SEA_dom
IPR002035, VWF_A
IPR036465, vWFA_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00008, EGF, 2 hits
PF07645, EGF_CA, 26 hits
PF12661, hEGF, 2 hits
PF00057, Ldl_recept_a, 2 hits
PF01390, SEA, 1 hit
PF00092, VWA, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00261, LDLRECEPTOR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181, EGF, 50 hits
SM00179, EGF_CA, 41 hits
SM00192, LDLa, 5 hits
SM00200, SEA, 2 hits
SM00327, VWA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53300, SSF53300, 1 hit
SSF57184, SSF57184, 1 hit
SSF57424, SSF57424, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010, ASX_HYDROXYL, 32 hits
PS00022, EGF_1, 1 hit
PS01186, EGF_2, 6 hits
PS50026, EGF_3, 42 hits
PS01187, EGF_CA, 1 hit
PS50068, LDLRA_2, 4 hits
PS50024, SEA, 2 hits
PS50234, VWFA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform aImported (identifier: P34576-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAGISIFFL FLHIPIFFVN CSNSTSCVAR EEFQCKMDDS CISMKKWQDG
60 70 80 90 100
VDDCYDGSDE VCLPWQFDCQ FGSPRCISKN KLHDKKIDCY SGFDEGCPAH
110 120 130 140 150
YFVCRDRSAC IEPSKYLNGV ADCKDKSDEP CAQNQFQCSD GTKCIPKAQF
160 170 180 190 200
QDGKEDCDDG SDEECTTSQF ACQCGTIKCV SDTFIMDGNW DCEDGSDEFI
210 220 230 240 250
NKTLTANCTR NNKVNIATNS LSLGKLKFCS GKNPCKPELG QVCVIIGGTW
260 270 280 290 300
RCVCKLGTFR PLGSDKCIPI ELLTRYRNAP SSKCSNSHEE QFGLLQGFQK
310 320 330 340 350
SLSSRKELER WSNIRRAPPR TLSGTTPSGS DGFLKSGAEQ VPFMFQEDKN
360 370 380 390 400
YVSVIPDEII DSYGTIMTPP EFHFNRDDIR CGNKTCGLHE SCQKNSESKY
410 420 430 440 450
ECICREGFTI FEGTCRELID ECAQGKHDCH PEARCVDALI GYECLCREGY
460 470 480 490 500
LDTSIDPKAR PGRKCRKLIN ECTNALMNDC SQNARCLDKP IGYTCRCQDD
510 520 530 540 550
YVDVSREGAR KPGRNCTQAI NECASNLHNC DTHAICQDQP VGYSCRCPFG
560 570 580 590 600
FIDSSPTALE PGRKCVQANN EAATTSTTTS QCIKEKNGET VCKCLLGYKN
610 620 630 640 650
VGTKTHLNCQ MEKRANPCQD YSLHDCDPVA ECFSEQPGYF QCQCPKGFTD
660 670 680 690 700
SSADKRFPGR KCVRAVDECA LGRHTCDPHA DCIDTHQGYT CKCRSGWSDT
710 720 730 740 750
SLDPLRSPGR SCKKADMCSN IDCAAEAECR ETPIGPMCQC VSGYVDVSRQ
760 770 780 790 800
HGRPAGRVCR AVVNECAEGR HDCSSHATCI DTADGFTCRC KDSYRDESSD
810 820 830 840 850
TLKHPGKNCV RTVQPDPPEC DVSDPMSCDP AKREVCIFVE NTYKCRCANG
860 870 880 890 900
YSRLPDGRCV VINECAEPRL NTCGKNAECI DLAEGYTCQC RSGYADISPV
910 920 930 940 950
SQPGRICRAR VNECSNKEKY NVDCSENAIC ADTEHSYSCR CRPGFADVSA
960 970 980 990 1000
AFNKLPGRRC IEAVNECASP SLNDCSKNAF CEDAKEGYIC TCRPGYVDNS
1010 1020 1030 1040 1050
PNAARHPGRI CTKPVEKIKT DLKDTSFSTD DGCDPKNPKC GANEACVQRH
1060 1070 1080 1090 1100
GQHNCECVET AFRYTDGSCR VYSACSKRNT CDKNAICLNR FDSYTCQCRP
1110 1120 1130 1140 1150
GYIDLSADLT NAPGRICKEL INECASSDNE CSPYARCIDA TNGYACQCLD
1160 1170 1180 1190 1200
GFIDVSSRYN KPPGRQCTNS NNECSEKSLN TCDENADCVD TPDGYTCQCY
1210 1220 1230 1240 1250
GGFVDVSSNA NLPPGRVCTV QTTCPKQKTD LVFLIDGSGS IGSYVFKNEV
1260 1270 1280 1290 1300
LRFVREFVEL FEIGRSKTRV GLIQYSDQIR HEFDLDQYGD RDSLLKGISE
1310 1320 1330 1340 1350
TQYLTGLTRT GAAIQHMVQE GFSERRGARP QQSDIARVAI ILTDGRSQDN
1360 1370 1380 1390 1400
VTGPADSARK LSINTFAIGV TDHVLASELE SIAGSPNRWF YVDKFKDLDT
1410 1420 1430 1440 1450
RLRSMIQKAA CPSPTKQETP SEDVCNPRTQ TGCDRSLNEH CAVENGRPRC
1460 1470 1480 1490 1500
VCPEGFTRHP FTRVCGGDLC NPQLITSCIF PEECQITPYK NFRCSCPEGY
1510 1520 1530 1540 1550
NRDYRSGFCV SVKEVQISPQ HDANCHNGGV RCSENERCTN DGSDWFCECL
1560 1570 1580 1590 1600
PGFERIRNGQ CAYPGSCNPN DPMSCDVRKR QQCLPRGNIY TCQCGRNEKR
1610 1620 1630 1640 1650
HPITDICLKN ECLTGEHDCD RSARCIDTDE SYICACQSGF IDHSPNPSER
1660 1670 1680 1690 1700
PGRVCVALQN ECLDGSNRCS PNALCTDTEE GYVCRCKSGF VDYSPNPQTF
1710 1720 1730 1740 1750
PGMVCKELVN ECTNPRLNQC DRNAHCIDTI EGYSCICKPG FVDMDEFGNP
1760 1770 1780 1790 1800
GRRCEQIKTN DKCSPGKNDC DRNARCIQIG DDDYSCACPP GFKDKSPSSS
1810 1820 1830 1840 1850
RPGRLCIPVI PECDNPTLND CDSPDRAVCT DTDDGYMCRC RQGFLDISPS
1860 1870 1880 1890 1900
ISVKPGRLCK PLQNECALGI DDCARDGGIC EDNPDSFTCR CAMNYLDVSF
1910 1920 1930 1940 1950
DRVTRPGRKC KRLINECQTG QNDCSEEATC TDTEDSYICA CPQSHIDLSP
1960 1970 1980 1990 2000
DTVNRPGRRC LMRINECTSN RHDCSPNADC IDTPESYKCR CRDDFVDESP
2010 2020 2030 2040 2050
DSSRRPGRIC RPALVDECRT GKHDCHVNAI CQDLPQGYTC QCSADFVDVS
2060 2070 2080 2090 2100
PHRASHPGRL CQPRPTPPPP ECRLDGGNQC KVHLNEVCRL MGGEPKCSCP
2110 2120 2130 2140 2150
VNYQRDSSGS CSIINECLFT QLNDCHTAAD CIDQVQGYTC QCRDGFKDIG
2160 2170 2180 2190 2200
DRRRPGRMCK PMVNECQYPH LNDCHQNAAC IDLEEGYECK CNQGFMDHSH
2210 2220 2230 2240 2250
GRPGRICKQL TNECLRPSLN SCDRNARCID KEEGYECECR DGFIDVSPSP
2260 2270 2280 2290 2300
TLKGRACREL VNECANSRLN DCDKNARCKD TMDSYECDCP VNSKDISPSP
2310 2320 2330 2340 2350
SFPGRVCLMF INECESGVHD CDPSATCRDN EQSFTCECPS GFVDRSPNKH
2360 2370 2380 2390 2400
ARPGRVCVKL VDECREGRHT CSSHADCRDL EEGYTCECRD GYVDRSPNLA
2410 2420 2430 2440 2450
SQPGRVCSAP EVCPPNHDCS SAAVCEPLGG MKYQCVCIQG YVDQSPGSQK
2460 2470 2480 2490 2500
GRVCVRNNAC HDPRLNTCSR NAICYDEPRG YRCECKRGFM DRSPDSSQRG
2510 2520 2530 2540 2550
RVCEPPPPPS PPPRHPCQDP ERNDCHPAGT CRATGAQSYT CECLSGYADR
2560 2570 2580 2590 2600
SPDPRNKPGR LCVLTEPVCL DPEQNDCHAA AICSEVNGPE KYTCKCRDGY
2610 2620 2630 2640 2650
TDESPDPLRR PGRICKGLIN ECLDRSLNDC HSLAVCKDLP NGYTCQCPIN
2660 2670 2680 2690 2700
AKDQSPDPRK PGRICSLSVN ECANPSLNSC SAFADCFDEE NGYRCRCRNG
2710 2720 2730 2740 2750
YHDDDPAHPG HRCSFMINEC DSSNLNDCDR NANCIDTAGG YDCACKAPYR
2760 2770 2780 2790 2800
DEGPPQSPGR ICRLNECLNP NRNTCDRNAD CRDLDYGYTC TCRHGFYDQS
2810 2820 2830 2840 2850
PNPQEPGRIC IEFQQEEHIE RVKVTTVQSE PRREFPCGRD DCIKARGEVC
2860 2870 2880 2890 2900
ISGEYCGCKP GEGRSASTGK CQEVQETPFE LRVVTRDQRP LMYSTEFGSQ
2910 2920 2930 2940 2950
KSPSYVEIVE LFEKNMARTF GGTSLAPRYV NTKVDYITHP KTKNSSWDQG
2960 2970 2980 2990 3000
LLFKYEVQTT KSQSQPIDEC ELWKQMQASL DRTNGAIGGG SLRVASDTDL
3010 3020 3030 3040 3050
LNPCKQQEEW GNCGGMSCKE HLKEVCIAGH ICGCPDGMKR RDANSECRVV
3060 3070 3080 3090 3100
ESWNVPLWVV RDKEKPIVFS ESFDNPQTPV YKDYSKRLEK GIEGCYPHTE
3110 3120 3130 3140 3150
LKNAFVTAEV NDIVNPVLMN ASYDTGLLFN TTVHFRKGMV HVPSDAYYQL
3160 3170 3180 3190 3200
IKYVTKENNN EVGDSELYLN PTQPDPFNPC FKNDCDPHGK CIEISKYAYK
3210 3220 3230 3240 3250
CECGVGYRDI NPQSPGKKCL PVHGFNECER KEDNECSENA RCIDLEHLYK
3260 3270 3280 3290 3300
CECLPSYYDT SPVGSVPGSL CVLDYCSDVN FCPTNTTCKN MEQQAECKCD
3310 3320 3330 3340 3350
AGFMDIRKSE KRTALMLGDD TLCMHVRDVD ECALGLNNCS GVAHCIDRAV
3360 3370 3380 3390 3400
GYTCKCPDGY IDGNPDEPGR VCGALLCDLC NAHGDCVHNT ATNNITCVCT
3410 3420 3430 3440 3450
DGWTGPQCQV APSNASLVLL ILLALLFLLL TLCCLLYFCT KCHCFKGRRF
3460 3470 3480 3490 3500
AGAGANGFGY RRGGAWPWST LEGSASSESG AEFSAMSAAG NDYYPDIGIP
3510 3520 3530 3540 3550
RAKLKSGMMA SGNTAEVRNM EVARLDQYLD ENAVRIPRAH LVDAHGDTSF
3560 3570 3580 3590 3600
DSLSEASSEY TIKEEIERKV ITDVTTKEIK TTTTTDEQGN TIVTTTEAVH
3610 3620 3630 3640 3650
PRDTTIVHGG GYTQNESSSS SFSGGERAYQ SQSQQQQSMS QGMSQSMSQH
3660 3670 3680 3690 3700
ATSAGYSSSG MESSAHNSGY ASIRHTGERE RGGSEEEFSI GRARGMAAAS
3710 3720 3730 3740 3750
SGYQHSSSEN REVEEYCSEE EDVEHSVGDK RTIVTKNHSY EPFVNGESER
3760
FKTEVVTSQT STHVTKK
Length:3,767
Mass (Da):417,291
Last modified:August 2, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8DA3AE5EA50AEB8E
GO
Isoform bImported (identifier: P34576-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-584: Missing.
     585-614: EKNGETVCKCLLGYKNVGTKTHLNCQMEKR → MGRLSLGILLLAAVTSIASDNSCGGRSRLG

Show »
Length:3,183
Mass (Da):351,819
Checksum:i5708A62E7161B151
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0164351 – 584Missing in isoform b. CuratedAdd BLAST584
Alternative sequenceiVSP_016436585 – 614EKNGE…QMEKR → MGRLSLGILLLAAVTSIASD NSCGGRSRLG in isoform b. CuratedAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF139060 mRNA Translation: AAD29428.1
Z30974, Z30423 Genomic DNA Translation: CAA83226.2
Z30974, Z30423 Genomic DNA Translation: CAH19087.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S42373

NCBI Reference Sequences

More...
RefSeqi
NP_001022674.1, NM_001027503.3 [P34576-1]
NP_001022675.1, NM_001027504.2 [P34576-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
K08E5.3a.1; K08E5.3a.1; WBGene00003482 [P34576-1]
K08E5.3b.1; K08E5.3b.1; WBGene00003482 [P34576-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
176430

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_K08E5.3

UCSC genome browser

More...
UCSCi
K08E5.3a, c. elegans [P34576-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF139060 mRNA Translation: AAD29428.1
Z30974, Z30423 Genomic DNA Translation: CAA83226.2
Z30974, Z30423 Genomic DNA Translation: CAH19087.1
PIRiS42373
RefSeqiNP_001022674.1, NM_001027503.3 [P34576-1]
NP_001022675.1, NM_001027504.2 [P34576-2]

3D structure databases

SMRiP34576
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi41624, 11 interactors
IntActiP34576, 2 interactors
STRINGi6239.K08E5.3a

PTM databases

iPTMnetiP34576

Proteomic databases

EPDiP34576
PaxDbiP34576
PeptideAtlasiP34576
PRIDEiP34576

Genome annotation databases

EnsemblMetazoaiK08E5.3a.1; K08E5.3a.1; WBGene00003482 [P34576-1]
K08E5.3b.1; K08E5.3b.1; WBGene00003482 [P34576-2]
GeneIDi176430
KEGGicel:CELE_K08E5.3
UCSCiK08E5.3a, c. elegans [P34576-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
176430
WormBaseiK08E5.3a ; CE28049 ; WBGene00003482 ; mua-3
K08E5.3b ; CE37256 ; WBGene00003482 ; mua-3

Phylogenomic databases

eggNOGiKOG1217, Eukaryota
InParanoidiP34576
OMAiLEEGYTC
OrthoDBi1174178at2759
PhylomeDBiP34576

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P34576

Gene expression databases

BgeeiWBGene00003482, Expressed in multi-cellular organism and 4 other tissues

Family and domain databases

CDDicd00112, LDLa, 2 hits
Gene3Di3.40.50.410, 1 hit
4.10.400.10, 4 hits
InterProiView protein in InterPro
IPR001881, EGF-like_Ca-bd_dom
IPR013032, EGF-like_CS
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR018097, EGF_Ca-bd_CS
IPR009030, Growth_fac_rcpt_cys_sf
IPR036055, LDL_receptor-like_sf
IPR002172, LDrepeatLR_classA_rpt
IPR000082, SEA_dom
IPR002035, VWF_A
IPR036465, vWFA_dom_sf
PfamiView protein in Pfam
PF00008, EGF, 2 hits
PF07645, EGF_CA, 26 hits
PF12661, hEGF, 2 hits
PF00057, Ldl_recept_a, 2 hits
PF01390, SEA, 1 hit
PF00092, VWA, 1 hit
PRINTSiPR00261, LDLRECEPTOR
SMARTiView protein in SMART
SM00181, EGF, 50 hits
SM00179, EGF_CA, 41 hits
SM00192, LDLa, 5 hits
SM00200, SEA, 2 hits
SM00327, VWA, 1 hit
SUPFAMiSSF53300, SSF53300, 1 hit
SSF57184, SSF57184, 1 hit
SSF57424, SSF57424, 3 hits
PROSITEiView protein in PROSITE
PS00010, ASX_HYDROXYL, 32 hits
PS00022, EGF_1, 1 hit
PS01186, EGF_2, 6 hits
PS50026, EGF_3, 42 hits
PS01187, EGF_CA, 1 hit
PS50068, LDLRA_2, 4 hits
PS50024, SEA, 2 hits
PS50234, VWFA, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMUA3_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P34576
Secondary accession number(s): Q21340, Q65ZC2, Q9UA13
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: August 2, 2002
Last modified: June 2, 2021
This is version 180 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again