Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (05 Jun 2019)
Sequence version 4 (05 Jul 2005)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Calpain clp-1

Gene

clp-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates (By similarity). Required for assembly and maintenance of integrin attachment complexes which are essential for maintenance of adult muscle (PubMed:22253611). Proteolytic activity is activated in response to increased intracellular Ca2+ levels during cell degeneration and promotes necrotic cell death (PubMed:12410314, PubMed:22479198).By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei371By similarity1
Active sitei527By similarity1
Active sitei551By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium-dependent cysteine-type endopeptidase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-6798695 Neutrophil degranulation

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C02.A03

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calpain clp-1 (EC:3.4.22.-PROSITE-ProRule annotation)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:clp-1Imported
ORF Names:C06G4.2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome III

Organism-specific databases

WormBase

More...
WormBasei
C06G4.2a ; CE37743 ; WBGene00000542 ; clp-1
C06G4.2b ; CE37744 ; WBGene00000542 ; clp-1
C06G4.2c ; CE00517 ; WBGene00000542 ; clp-1
C06G4.2d ; CE30486 ; WBGene00000542 ; clp-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown results in adult muscle defects which include irregularities in sarcomeric structures, disorganized integrin attachment complexes, and increased mitochondrial fragmentation (PubMed:22253611). RNAi-mediated knockdown in integrin attachment complex component mutants unc-112 (e669su250) and unc-52 (r367) blocks the protein degradation which normally results from complex disruption (PubMed:22253611). RNAi-mediated knockdown suppresses cell death in the neurodegenerative models deg-3 (u662), gsa-1 (Q227L) and mec-4 (u231) (PubMed:12410314).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002077341 – 780Calpain clp-1Add BLAST780

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P34308

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P34308

PeptideAtlas

More...
PeptideAtlasi
P34308

PRoteomics IDEntifications database

More...
PRIDEi
P34308

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in muscle and neuronal tissues (PubMed:12410314, PubMed:22479198). Expressed in the ventral and dorsal nerve cord, intestinal and hypodermal tissues (PubMed:22479198).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00000542 Expressed in 5 organ(s), highest expression level in material anatomical entity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.C06G4.2a

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P34308

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini316 – 611Calpain catalyticPROSITE-ProRule annotationAdd BLAST296

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi21 – 288Gly-richAdd BLAST268

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0045 Eukaryota
ENOG410XP0B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000169240

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000020136

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P34308

KEGG Orthology (KO)

More...
KOi
K08585

Identification of Orthologs from Complete Genome Data

More...
OMAi
DEVYQMT

Database of Orthologous Groups

More...
OrthoDBi
704215at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P34308

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00214 Calpain_III, 1 hit
cd00044 CysPc, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033883 C2_III
IPR022684 Calpain_cysteine_protease
IPR022682 Calpain_domain_III
IPR022683 Calpain_III
IPR036213 Calpain_III_sf
IPR038765 Papain-like_cys_pep_sf
IPR000169 Pept_cys_AS
IPR001300 Peptidase_C2_calpain_cat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01067 Calpain_III, 1 hit
PF00648 Peptidase_C2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00704 CALPAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00720 calpain_III, 1 hit
SM00230 CysPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49758 SSF49758, 1 hit
SSF54001 SSF54001, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50203 CALPAIN_CAT, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.
Isoform aImported (identifier: P34308-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADDEEEIIQ KVEVKPDEFN GLIGSIAGNL IRDKVGGAGG DILGGLASNF
60 70 80 90 100
FGGGGGGGGG GGGGGFGGGN GGFGGGSNYD QGGNGNSGDQ QKRKRDMAKD
110 120 130 140 150
LIGGIFDNVV NRKGKKEQDN YGGGGNYGGG GGNQGGGGGG GFNFNDIGGL
160 170 180 190 200
INSMGGGGGG GQRQGGGGGG FGDILGGIGS LIGGGGGGQY NGGGGNVNPN
210 220 230 240 250
NLNGGMVNVI GNLIGEAAHR FLGVDPGTGR IIGAVAGNVI MGLGGKDNSL
260 270 280 290 300
GNIGKVILDN IISGKFRRDV DPFVRPGPDP DRGGGGSGPS PISPRPTTEP
310 320 330 340 350
QDFYELRDQC LESKRLFEDP QFLANDSSLF FSKRPPKRVE WLRPGEITRE
360 370 380 390 400
PQLITEGHSR FDVIQGELGD CWLLAAAANL TLKDELFYRV VPPDQSFTEN
410 420 430 440 450
YAGIFHFQFW QYGKWVDVVI DDRLPTSNGE LLYMHSASNN EFWSALLEKA
460 470 480 490 500
YAKLFGSYEA LKGGTTSEAL EDMTGGLTEF IDLKNPPRNL MQMMMRGFEM
510 520 530 540 550
GSLFGCSIEA DPNVWEAKMS NGLVKGHAYS ITGCRIVDGP NGQTCILRIR
560 570 580 590 600
NPWGNEQEWN GPWSDNSREW RSVPDSVKQD MGLKFDHDGE FWMSFDDFMR
610 620 630 640 650
NFEKMEICNL GPDVMDEVYQ MTGVKAAGMV WAANTHDGAW VRNQTAGGCR
660 670 680 690 700
NYINTFANNP QFRVQLTDSD PDDDDELCTV IFAVLQKYRR NLKQDGLDNV
710 720 730 740 750
PIGFAVYDAG NNRGRLSKQF FAANKSAMRS AAFINLREMT GRFRVPPGNY
760 770 780
VVVPSTFEPN EEAEFMLRVY TNGFIESEEL
Note: No experimental confirmation available.
Length:780
Mass (Da):83,643
Last modified:July 5, 2005 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC1DFA4E5671F7835
GO
Isoform bImported (identifier: P34308-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-121: Missing.
     708-708: D → DMNN

Note: No experimental confirmation available.
Show »
Length:737
Mass (Da):78,904
Checksum:i0B91CF87AD6FA281
GO
Isoform cImported (identifier: P34308-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-113: SNYDQGGNGNSGDQQKRKRDMAKDLIGGIFDNVVNRK → IFIFKIVRQKFPKNSSSFFCVRKHLDSLKTSPCGLDQ
     114-780: Missing.

Note: No experimental confirmation available.
Show »
Length:113
Mass (Da):11,283
Checksum:i2DDF5D0C0A40C297
GO
Isoform dImported (identifier: P34308-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-100: SNYDQGGNGNSGDQQKRKRDMAKD → GGGSGGGGGGNNIGSLVGSLIGGG
     101-121: Missing.

Note: No experimental confirmation available.
Show »
Length:759
Mass (Da):80,442
Checksum:i5CC728E8C5372689
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00524776 – 121Missing in isoform b. CuratedAdd BLAST46
Alternative sequenceiVSP_00524977 – 113SNYDQ…VVNRK → IFIFKIVRQKFPKNSSSFFC VRKHLDSLKTSPCGLDQ in isoform c. CuratedAdd BLAST37
Alternative sequenceiVSP_00524877 – 100SNYDQ…DMAKD → GGGSGGGGGGNNIGSLVGSL IGGG in isoform d. CuratedAdd BLAST24
Alternative sequenceiVSP_005250101 – 121Missing in isoform d. CuratedAdd BLAST21
Alternative sequenceiVSP_005251114 – 780Missing in isoform c. CuratedAdd BLAST667
Alternative sequenceiVSP_005252708D → DMNN in isoform b. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX284603 Genomic DNA Translation: CCD63432.1
BX284603 Genomic DNA Translation: CCD63433.1
BX284603 Genomic DNA Translation: CCD63434.1
BX284603 Genomic DNA Translation: CCD63435.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S44749
S44750

NCBI Reference Sequences

More...
RefSeqi
NP_498740.2, NM_066339.5 [P34308-2]
NP_498741.3, NM_066340.4 [P34308-1]
NP_741237.1, NM_171886.4 [P34308-4]
NP_741238.1, NM_171201.1 [P34308-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
C06G4.2a.1; C06G4.2a.1; WBGene00000542 [P34308-1]
C06G4.2a.2; C06G4.2a.2; WBGene00000542 [P34308-1]
C06G4.2b.1; C06G4.2b.1; WBGene00000542 [P34308-2]
C06G4.2b.2; C06G4.2b.2; WBGene00000542 [P34308-2]
C06G4.2b.3; C06G4.2b.3; WBGene00000542 [P34308-2]
C06G4.2c; C06G4.2c; WBGene00000542 [P34308-3]
C06G4.2d; C06G4.2d; WBGene00000542 [P34308-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
176122

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_C06G4.2

UCSC genome browser

More...
UCSCi
C06G4.2a.1 c. elegans [P34308-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX284603 Genomic DNA Translation: CCD63432.1
BX284603 Genomic DNA Translation: CCD63433.1
BX284603 Genomic DNA Translation: CCD63434.1
BX284603 Genomic DNA Translation: CCD63435.1
PIRiS44749
S44750
RefSeqiNP_498740.2, NM_066339.5 [P34308-2]
NP_498741.3, NM_066340.4 [P34308-1]
NP_741237.1, NM_171886.4 [P34308-4]
NP_741238.1, NM_171201.1 [P34308-3]

3D structure databases

SMRiP34308
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi6239.C06G4.2a

Protein family/group databases

MEROPSiC02.A03

Proteomic databases

EPDiP34308
PaxDbiP34308
PeptideAtlasiP34308
PRIDEiP34308

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC06G4.2a.1; C06G4.2a.1; WBGene00000542 [P34308-1]
C06G4.2a.2; C06G4.2a.2; WBGene00000542 [P34308-1]
C06G4.2b.1; C06G4.2b.1; WBGene00000542 [P34308-2]
C06G4.2b.2; C06G4.2b.2; WBGene00000542 [P34308-2]
C06G4.2b.3; C06G4.2b.3; WBGene00000542 [P34308-2]
C06G4.2c; C06G4.2c; WBGene00000542 [P34308-3]
C06G4.2d; C06G4.2d; WBGene00000542 [P34308-4]
GeneIDi176122
KEGGicel:CELE_C06G4.2
UCSCiC06G4.2a.1 c. elegans [P34308-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
176122
WormBaseiC06G4.2a ; CE37743 ; WBGene00000542 ; clp-1
C06G4.2b ; CE37744 ; WBGene00000542 ; clp-1
C06G4.2c ; CE00517 ; WBGene00000542 ; clp-1
C06G4.2d ; CE30486 ; WBGene00000542 ; clp-1

Phylogenomic databases

eggNOGiKOG0045 Eukaryota
ENOG410XP0B LUCA
GeneTreeiENSGT00940000169240
HOGENOMiHOG000020136
InParanoidiP34308
KOiK08585
OMAiDEVYQMT
OrthoDBi704215at2759
PhylomeDBiP34308

Enzyme and pathway databases

ReactomeiR-CEL-6798695 Neutrophil degranulation

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P34308

Gene expression databases

BgeeiWBGene00000542 Expressed in 5 organ(s), highest expression level in material anatomical entity

Family and domain databases

CDDicd00214 Calpain_III, 1 hit
cd00044 CysPc, 1 hit
InterProiView protein in InterPro
IPR033883 C2_III
IPR022684 Calpain_cysteine_protease
IPR022682 Calpain_domain_III
IPR022683 Calpain_III
IPR036213 Calpain_III_sf
IPR038765 Papain-like_cys_pep_sf
IPR000169 Pept_cys_AS
IPR001300 Peptidase_C2_calpain_cat
PfamiView protein in Pfam
PF01067 Calpain_III, 1 hit
PF00648 Peptidase_C2, 1 hit
PRINTSiPR00704 CALPAIN
SMARTiView protein in SMART
SM00720 calpain_III, 1 hit
SM00230 CysPc, 1 hit
SUPFAMiSSF49758 SSF49758, 1 hit
SSF54001 SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS50203 CALPAIN_CAT, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAN_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P34308
Secondary accession number(s): P34309, Q5DX51, Q5DX52
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: July 5, 2005
Last modified: June 5, 2019
This is version 150 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again