Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fasciclin-2

Gene

Fas2

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Neuronal recognition molecule for the MP1 axon pathway, pathway recognition for axons during the development of nerve fascicles.1 Publication

GO - Molecular functioni

  • cell-cell adhesion mediator activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processCell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-DME-375165 NCAM signaling for neurite out-growth
R-DME-419037 NCAM1 interactions
R-DME-445144 Signal transduction by L1
R-DME-5673001 RAF/MAP kinase cascade

Names & Taxonomyi

Protein namesi
Recommended name:
Fasciclin-2
Alternative name(s):
Fasciclin II
Short name:
FAS II
Gene namesi
Name:Fas2
ORF Names:CG3665
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0000635 Fas2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini29 – 751ExtracellularSequence analysisAdd BLAST723
Transmembranei752 – 769HelicalSequence analysisAdd BLAST18
Topological domaini770 – 873CytoplasmicSequence analysisAdd BLAST104

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 28Sequence analysisAdd BLAST28
ChainiPRO_000001475829 – 873Fasciclin-2Add BLAST845

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi54 ↔ 116PROSITE-ProRule annotation
Glycosylationi74N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi159 ↔ 207PROSITE-ProRule annotation
Glycosylationi250N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi251 ↔ 302PROSITE-ProRule annotation
Glycosylationi330N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi343 ↔ 407PROSITE-ProRule annotation
Glycosylationi448N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi451 ↔ 504PROSITE-ProRule annotation
Glycosylationi458N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi576N-linked (GlcNAc...) asparagine1 Publication1
Modified residuei827Phosphoserine1 Publication1
Modified residuei841Phosphothreonine1 Publication1
Modified residuei845Phosphoserine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein, Phosphoprotein

Proteomic databases

PaxDbiP34082
PRIDEiP34082

PTM databases

iPTMnetiP34082

Expressioni

Tissue specificityi

In embryos, both isoforms are initially expressed on the surface of the axons in the MP1 pathway and later on several other longitudinal axon fascicles.1 Publication

Gene expression databases

BgeeiFBgn0000635 Expressed in 29 organ(s), highest expression level in eye disc (Drosophila)
ExpressionAtlasiP34082 baseline and differential
GenevisibleiP34082 DM

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi57881, 294 interactors
IntActiP34082, 669 interactors
STRINGi7227.FBpp0070633

Structurei

3D structure databases

ProteinModelPortaliP34082
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 131Ig-like C2-type 1Add BLAST101
Domaini138 – 223Ig-like C2-type 2Add BLAST86
Domaini230 – 318Ig-like C2-type 3Add BLAST89
Domaini323 – 423Ig-like C2-type 4Add BLAST101
Domaini428 – 520Ig-like C2-type 5Add BLAST93
Domaini524 – 622Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST99
Domaini638 – 738Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST101

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IQJI Eukaryota
ENOG410XTGB LUCA
GeneTreeiENSGT00860000133697
InParanoidiP34082
KOiK06491
OMAiVSLEVQI
OrthoDBiEOG091G02K3
PhylomeDBiP34082

Family and domain databases

CDDicd00063 FN3, 2 hits
Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR009138 Neural_cell_adh
PfamiView protein in Pfam
PF00041 fn3, 2 hits
PF07679 I-set, 3 hits
PRINTSiPR01838 NCAMFAMILY
SMARTiView protein in SMART
SM00060 FN3, 2 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 2 hits
PS50835 IG_LIKE, 5 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P34082-1) [UniParc]FASTAAdd to basket
Also known as: A, Membrane-linked

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGELPPNSVG VFLALLLCSC SLIELTRAQS PILEIYPKQE VQRKPVGKPL
60 70 80 90 100
ILTCRPTVPE PSLVADLQWK DNRNNTILPK PNGRNQPPMY TETLPGESLA
110 120 130 140 150
LMITSLSVEM GGKYYCTASY ANTEILEKGV TIKTYVAITW TNAPENQYPT
160 170 180 190 200
LGQDYVVMCE VKADPNPTID WLRNGDPIRT TNDKYVVQTN GLLIRNVQES
210 220 230 240 250
DEGIYTCRAA VIETGELLER TIRVEVFIQP EIISLPTNLE AVEGKPFAAN
260 270 280 290 300
CTARGKPVPE ISWIRDATQL NVATADRFQV NPQTGLVTIS SVSQDDYGTY
310 320 330 340 350
TCLAKNRAGV VDQKTKLNVL VRPQIYELYN VTGARTKEIA ITCRAKGRPA
360 370 380 390 400
PAITFRRWGT QEEYTNGQQD DDPRIILEPN FDEERGESTG TLRISNAERS
410 420 430 440 450
DDGLYQCIAR NKGADAYKTG HITVEFAPDF SHMKELPPVF SWEQRKANLS
460 470 480 490 500
CLAMGIPNAT IEWHWNGRKI KDLYDTNLKI VGTGPRSDLI VHPVTRQYYS
510 520 530 540 550
GYKCIATNIH GTAEHDMQLK EARVPDFVSE AKPSQLTATT MTFDIRGPST
560 570 580 590 600
ELGLPILAYS VQYKEALNPD WSTAYNRSWS PDSPYIVEGL RPQTEYSFRF
610 620 630 640 650
AARNQVGLGN WGVNQQQSTP RRSAPEEPKP LHNPVQHDKE EPVVVSPYSD
660 670 680 690 700
HFELRWGVPA DNGEPIDRYQ IKYCPGVKIS GTWTELENSC NTVEVMETTS
710 720 730 740 750
FEMTQLVGNT YYRIELKAHN AIGYSSPASI IMKTTRGIDV IQVAERQVFS
760 770 780 790 800
SAAIVGIAIG GVLLLLFVVD LLCCITVHMG VMATMCRKAK RSPSEIDDEA
810 820 830 840 850
KLGSGQLVKE PPPSPLPLPP PVKLGGSPMS TPLDEKEPLR TPTGSIKQNS
860 870
TIEFDGRFVH SRSGEIIGKN SAV
Length:873
Mass (Da):96,926
Last modified:February 1, 1994 - v1
Checksum:iE48F0484CCE62AC9
GO
Isoform 2 (identifier: P34082-2) [UniParc]FASTAAdd to basket
Also known as: C, Phosphatidylinositol-linked

The sequence of this isoform differs from the canonical sequence as follows:
     738-811: IDVIQVAERQ...LGSGQLVKEP → ESDSANNNLG...LLSVLASMLA
     812-873: Missing.

Note: GPI-anchored form.
Show »
Length:811
Mass (Da):90,068
Checksum:iFAB06B4D2ECC57B9
GO
Isoform 3 (identifier: P34082-3) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     737-773: GIDVIQVAERQVFSSAAIVGIAIGGVLLLLFVVDLLC → DNPHPSTSGAAPLAQLLVIFTALPTMLLILPPTTHTA
     774-873: Missing.

Show »
Length:773
Mass (Da):86,290
Checksum:iB43E6CCC8E3D7D46
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9PJ19M9PJ19_DROME
Fasciclin 2, isoform D
Fas2 1D4, Ab 1D4, anon-EST:Liang-1.60, clone 1.60, CT12301
844Annotation score:
X2JAF4X2JAF4_DROME
Fasciclin 2, isoform G
Fas2 1D4, Ab 1D4, anon-EST:Liang-1.60, clone 1.60, CT12301
885Annotation score:
X2JCI0X2JCI0_DROME
Fasciclin 2, isoform H
Fas2 1D4, Ab 1D4, anon-EST:Liang-1.60, clone 1.60, CT12301
832Annotation score:
M9PGF6M9PGF6_DROME
Fasciclin 2, isoform F
Fas2 1D4, Ab 1D4, anon-EST:Liang-1.60, clone 1.60, CT12301
859Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti804S → R in CAA21826 (PubMed:10731137).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002506737 – 773GIDVI…VDLLC → DNPHPSTSGAAPLAQLLVIF TALPTMLLILPPTTHTA in isoform 3. CuratedAdd BLAST37
Alternative sequenceiVSP_002508738 – 811IDVIQ…LVKEP → ESDSANNNLGTLLYSAGFNS GVGALHKRLFTTTTTTTATS TTTITSITTATTTIITLATT ISITLLSVLASMLA in isoform 2. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_002507774 – 873Missing in isoform 3. CuratedAdd BLAST100
Alternative sequenceiVSP_002509812 – 873Missing in isoform 2. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M77165 mRNA Translation: AAA28527.1
M77166 mRNA Translation: AAA28528.1
AL033125 Genomic DNA Translation: CAA21825.1
AE014298 Genomic DNA Translation: AAF45925.2
AE014298 Genomic DNA Translation: AAN09118.1
AE014298 Genomic DNA Translation: AAN09119.1
BT014661 mRNA Translation: AAT27285.1
AL033125 Genomic DNA Translation: CAA21826.1
PIRiA41054
B41054
RefSeqiNP_525066.1, NM_080327.3 [P34082-1]
NP_726911.1, NM_167004.2 [P34082-3]
NP_726912.1, NM_167005.2 [P34082-2]
UniGeneiDm.1687

Genome annotation databases

EnsemblMetazoaiFBtr0070665; FBpp0070633; FBgn0000635 [P34082-1]
FBtr0070666; FBpp0070634; FBgn0000635 [P34082-3]
FBtr0070667; FBpp0070635; FBgn0000635 [P34082-2]
GeneIDi31364
KEGGidme:Dmel_CG3665

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M77165 mRNA Translation: AAA28527.1
M77166 mRNA Translation: AAA28528.1
AL033125 Genomic DNA Translation: CAA21825.1
AE014298 Genomic DNA Translation: AAF45925.2
AE014298 Genomic DNA Translation: AAN09118.1
AE014298 Genomic DNA Translation: AAN09119.1
BT014661 mRNA Translation: AAT27285.1
AL033125 Genomic DNA Translation: CAA21826.1
PIRiA41054
B41054
RefSeqiNP_525066.1, NM_080327.3 [P34082-1]
NP_726911.1, NM_167004.2 [P34082-3]
NP_726912.1, NM_167005.2 [P34082-2]
UniGeneiDm.1687

3D structure databases

ProteinModelPortaliP34082
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi57881, 294 interactors
IntActiP34082, 669 interactors
STRINGi7227.FBpp0070633

PTM databases

iPTMnetiP34082

Proteomic databases

PaxDbiP34082
PRIDEiP34082

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0070665; FBpp0070633; FBgn0000635 [P34082-1]
FBtr0070666; FBpp0070634; FBgn0000635 [P34082-3]
FBtr0070667; FBpp0070635; FBgn0000635 [P34082-2]
GeneIDi31364
KEGGidme:Dmel_CG3665

Organism-specific databases

CTDi31364
FlyBaseiFBgn0000635 Fas2

Phylogenomic databases

eggNOGiENOG410IQJI Eukaryota
ENOG410XTGB LUCA
GeneTreeiENSGT00860000133697
InParanoidiP34082
KOiK06491
OMAiVSLEVQI
OrthoDBiEOG091G02K3
PhylomeDBiP34082

Enzyme and pathway databases

ReactomeiR-DME-375165 NCAM signaling for neurite out-growth
R-DME-419037 NCAM1 interactions
R-DME-445144 Signal transduction by L1
R-DME-5673001 RAF/MAP kinase cascade

Miscellaneous databases

ChiTaRSiFas2 fly
GenomeRNAii31364
PROiPR:P34082

Gene expression databases

BgeeiFBgn0000635 Expressed in 29 organ(s), highest expression level in eye disc (Drosophila)
ExpressionAtlasiP34082 baseline and differential
GenevisibleiP34082 DM

Family and domain databases

CDDicd00063 FN3, 2 hits
Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR009138 Neural_cell_adh
PfamiView protein in Pfam
PF00041 fn3, 2 hits
PF07679 I-set, 3 hits
PRINTSiPR01838 NCAMFAMILY
SMARTiView protein in SMART
SM00060 FN3, 2 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 2 hits
PS50835 IG_LIKE, 5 hits
ProtoNetiSearch...

Entry informationi

Entry nameiFAS2_DROME
AccessioniPrimary (citable) accession number: P34082
Secondary accession number(s): P34083
, Q6IDE4, Q8IRS5, Q9W4M6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: November 7, 2018
This is version 187 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again