Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor AP-2-alpha

Gene

Tfap2a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor AP-2-alpha
Short name:
AP2-alpha
Alternative name(s):
AP-2 transcription factor
Activating enhancer-binding protein 2-alpha
Activator protein 2
Short name:
AP-2
Gene namesi
Name:Tfap2a
Synonyms:Ap2tf, Tcfap2a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:104671 Tfap2a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001847971 – 437Transcription factor AP-2-alphaAdd BLAST437

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki10Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternateBy similarity
Cross-linki10Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Cross-linki177Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki184Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei239Phosphoserine; by PKABy similarity1

Post-translational modificationi

Sumoylated on Lys-10; which inhibits transcriptional activity.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP34056
PaxDbiP34056
PeptideAtlasiP34056
PRIDEiP34056

PTM databases

iPTMnetiP34056
PhosphoSitePlusiP34056

Expressioni

Developmental stagei

Expressed in the embryonic heart. Expressed from embryo day 9.5 to birth. At day 12.5, expressed in the midbrain, hindbrain, spinal cord, sensory ganglia, epidermis, nephric system and limbs. At mid-embryogenesis, isoform 3 is the most abundant form in the nervous system and total embryo, but the least abundant form in the epidermis. In adults, AP-2A is expressed in the eye, skin, kidney, prostate, thymus, skeletal muscle and very weakly, in the brain. Highest expression found in skin and eye.1 Publication

Inductioni

All isoforms are induced during retinoic acid-mediated differentiation and by cAMP stimulation of primary astrocytes. Isoform 3 is most strongly induced in the former case, isoform 1 in the latter case.

Gene expression databases

CleanExiMM_TCFAP2A

Interactioni

Subunit structurei

Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with UBE2I. Interacts with RALBP1 in a complex also containing EPN1 and NUMB during interphase and mitosis (By similarity). Interacts with CITED4. Interacts with KCTD1; this interaction represses transcription activation. Interacts (via C-terminus) with CITED2 (via C-terminus); the interaction stimulates TFAP2A-transcriptional activation. Interacts (via N-terminus) with EP300 (via N-terminus); the interaction requires CITED2 (By similarity). Interacts with KCTD15; this interaction inhibits TFAP2A transcriptional activation (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204011, 6 interactors
CORUMiP34056
STRINGi10090.ENSMUSP00000105822

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni280 – 410H-S-H (helix-span-helix), dimerizationAdd BLAST131

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi57 – 62PPxY motif6

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi29 – 117Gln/Pro-rich (transactivation domain)Add BLAST89

Domaini

The PPxY motif mediates interaction with WWOX.By similarity

Sequence similaritiesi

Belongs to the AP-2 family.Curated

Phylogenomic databases

eggNOGiKOG3811 Eukaryota
ENOG410XR9E LUCA
HOVERGENiHBG002455
InParanoidiP34056
KOiK09176
PhylomeDBiP34056
TreeFamiTF313718

Family and domain databases

InterProiView protein in InterPro
IPR004979 TF_AP2
IPR008121 TF_AP2_alpha_N
IPR013854 TF_AP2_C
PANTHERiPTHR10812 PTHR10812, 1 hit
PfamiView protein in Pfam
PF03299 TF_AP-2, 1 hit
PRINTSiPR01749 AP2ATNSCPFCT
PR01748 AP2TNSCPFCT

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P34056-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLWKLTDNIK YEDCEDRHDG TSNGTARLPQ LGTVGQSPYT SAPPLSHTPN
60 70 80 90 100
ADFQPPYFPP PYQPIYPQSQ DPYSHVNDPY SLNPLHAQPQ PQHPGWPGQR
110 120 130 140 150
QSQESGLLHT HRGLPHQLSG LDPRRDYRRH EDLLHGPHAL GSGLGDLPIH
160 170 180 190 200
SLPHAIEDVP HVEDPGINIP DQTVIKKGPV SLSKSNSNAV SAIPINKDNL
210 220 230 240 250
FGGVVNPNEV FCSVPGRLSL LSSTSKYKVT VAEVQRRLSP PECLNASLLG
260 270 280 290 300
GVLRRAKSKN GGRSLREKLD KIGLNLPAGR RKAANVTLLT SLVEGEAVHL
310 320 330 340 350
ARDFGYVCET EFPAKAVAEF LNRQHSDPNE QVARKNMLLA TKQICKEFTD
360 370 380 390 400
LLAQDRSPLG NSRPNPILEP GIQSCLTHFN LISHGFGSPA VCAAVTALQN
410 420 430
YLTEALKAMD KMYLSNNPNS HTDNSAKSSD KEEKHRK
Length:437
Mass (Da):47,971
Last modified:November 1, 1995 - v2
Checksum:i901F456EE07AE69C
GO
Isoform 2 (identifier: P34056-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     16-160: Missing.

Show »
Length:292
Mass (Da):31,960
Checksum:i6E9B01E97186E4E1
GO
Isoform 3 (identifier: P34056-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MLWKLTDNIKYEDCE → MLVHSFSAM

Show »
Length:431
Mass (Da):47,092
Checksum:i7CA39A800983538C
GO
Isoform 4 (identifier: P34056-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MLWKLTDNIKYEDCE → MNSVVVDTPYFGGLPTLGLWNGFSRVVEALRLISSSPSRLAFFQ

Show »
Length:466
Mass (Da):50,900
Checksum:i49A69CBE5826B8BB
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0R4J1E6A0A0R4J1E6_MOUSE
Transcription factor AP-2-alpha
Tfap2a
437Annotation score:
Q8BPN4Q8BPN4_MOUSE
Transcription factor AP-2, alpha, i...
Tfap2a Tcfap2a, mCG_5075
431Annotation score:
A0A286YCU0A0A286YCU0_MOUSE
Transcription factor AP-2, alpha, i...
Tfap2a Tcfap2a, mCG_5075
433Annotation score:
A0A286YD43A0A286YD43_MOUSE
Transcription factor AP-2, alpha, i...
Tfap2a Tcfap2a, mCG_5075
466Annotation score:
A0A286YDR3A0A286YDR3_MOUSE
Transcription factor AP-2, alpha, i...
Tfap2a Tcfap2a, mCG_5075
439Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti38P → S in AAH07471 (PubMed:15489334).Curated1
Sequence conflicti139A → G (PubMed:15489334).Curated1
Sequence conflicti139A → G (PubMed:7750631).Curated1
Sequence conflicti158 – 159DV → RL (PubMed:16141072).Curated2
Sequence conflicti390Missing (PubMed:1989904).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0064021 – 15MLWKL…YEDCE → MLVHSFSAM in isoform 3. CuratedAdd BLAST15
Alternative sequenceiVSP_0064031 – 15MLWKL…YEDCE → MNSVVVDTPYFGGLPTLGLW NGFSRVVEALRLISSSPSRL AFFQ in isoform 4. CuratedAdd BLAST15
Alternative sequenceiVSP_00640416 – 160Missing in isoform 2. CuratedAdd BLAST145

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74216 mRNA Translation: CAA52292.1
BC018226 mRNA Translation: AAH18226.1
BC007471 mRNA Translation: AAH07471.1
U17285 mRNA Translation: AAA85681.1
U17291, U17289 Genomic DNA Translation: AAA85678.1
U17286 mRNA Translation: AAA85682.1
U17287 mRNA Translation: AAA85683.1
U17291, U17290 Genomic DNA Translation: AAA85679.1
U17288 mRNA Translation: AAA85684.1
U17291 Genomic DNA Translation: AAA85680.1
AK013900 mRNA Translation: BAB29047.1
X57012 mRNA Translation: CAA40331.1
CCDSiCCDS26467.1 [P34056-1]
CCDS49243.1 [P34056-3]
PIRiS42111
RefSeqiNP_001288603.1, NM_001301674.1
NP_035677.2, NM_011547.4
UniGeneiMm.487150
Mm.85544

Genome annotation databases

GeneIDi21418
KEGGimmu:21418
UCSCiuc007qei.1 mouse [P34056-4]
uc011yyq.1 mouse [P34056-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74216 mRNA Translation: CAA52292.1
BC018226 mRNA Translation: AAH18226.1
BC007471 mRNA Translation: AAH07471.1
U17285 mRNA Translation: AAA85681.1
U17291, U17289 Genomic DNA Translation: AAA85678.1
U17286 mRNA Translation: AAA85682.1
U17287 mRNA Translation: AAA85683.1
U17291, U17290 Genomic DNA Translation: AAA85679.1
U17288 mRNA Translation: AAA85684.1
U17291 Genomic DNA Translation: AAA85680.1
AK013900 mRNA Translation: BAB29047.1
X57012 mRNA Translation: CAA40331.1
CCDSiCCDS26467.1 [P34056-1]
CCDS49243.1 [P34056-3]
PIRiS42111
RefSeqiNP_001288603.1, NM_001301674.1
NP_035677.2, NM_011547.4
UniGeneiMm.487150
Mm.85544

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204011, 6 interactors
CORUMiP34056
STRINGi10090.ENSMUSP00000105822

PTM databases

iPTMnetiP34056
PhosphoSitePlusiP34056

Proteomic databases

MaxQBiP34056
PaxDbiP34056
PeptideAtlasiP34056
PRIDEiP34056

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi21418
KEGGimmu:21418
UCSCiuc007qei.1 mouse [P34056-4]
uc011yyq.1 mouse [P34056-2]

Organism-specific databases

CTDi7020
MGIiMGI:104671 Tfap2a

Phylogenomic databases

eggNOGiKOG3811 Eukaryota
ENOG410XR9E LUCA
HOVERGENiHBG002455
InParanoidiP34056
KOiK09176
PhylomeDBiP34056
TreeFamiTF313718

Miscellaneous databases

ChiTaRSiTfap2a mouse
PROiPR:P34056
SOURCEiSearch...

Gene expression databases

CleanExiMM_TCFAP2A

Family and domain databases

InterProiView protein in InterPro
IPR004979 TF_AP2
IPR008121 TF_AP2_alpha_N
IPR013854 TF_AP2_C
PANTHERiPTHR10812 PTHR10812, 1 hit
PfamiView protein in Pfam
PF03299 TF_AP-2, 1 hit
PRINTSiPR01749 AP2ATNSCPFCT
PR01748 AP2TNSCPFCT
ProtoNetiSearch...

Entry informationi

Entry nameiAP2A_MOUSE
AccessioniPrimary (citable) accession number: P34056
Secondary accession number(s): Q60740
, Q60741, Q60742, Q60743, Q62067, Q62068, Q62069, Q91VX0, Q9CRY4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: November 1, 1995
Last modified: November 7, 2018
This is version 167 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again