Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

T-lymphocyte activation antigen CD80

Gene

CD80

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation.1 Publication
(Microbial infection) Acts as a receptor for adenovirus subgroup B.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cytokine-mediated signaling pathway Source: Reactome
  • intracellular signal transduction Source: UniProtKB
  • positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process Source: UniProtKB
  • positive regulation of interleukin-2 biosynthetic process Source: UniProtKB
  • positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKB
  • positive regulation of protein kinase B signaling Source: Reactome
  • positive regulation of signal transduction Source: UniProtKB
  • positive regulation of T-helper 1 cell differentiation Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • T cell costimulation Source: Reactome

Keywordsi

Molecular functionHost cell receptor for virus entry, Receptor
Biological processHost-virus interaction

Enzyme and pathway databases

ReactomeiR-HSA-1257604 PIP3 activates AKT signaling
R-HSA-2219530 Constitutive Signaling by Aberrant PI3K in Cancer
R-HSA-389356 CD28 co-stimulation
R-HSA-389357 CD28 dependent PI3K/Akt signaling
R-HSA-389359 CD28 dependent Vav1 pathway
R-HSA-389513 CTLA4 inhibitory signaling
R-HSA-6783783 Interleukin-10 signaling
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
SIGNORiP33681

Names & Taxonomyi

Protein namesi
Recommended name:
T-lymphocyte activation antigen CD80
Alternative name(s):
Activation B7-1 antigen
BB1
CTLA-4 counter-receptor B7.1
Short name:
B7
CD_antigen: CD80
Gene namesi
Name:CD80
Synonyms:CD28LG, CD28LG1, LAB7
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000121594.11
HGNCiHGNC:1700 CD80
MIMi112203 gene
neXtProtiNX_P33681

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini35 – 242ExtracellularSequence analysisAdd BLAST208
Transmembranei243 – 263HelicalSequence analysisAdd BLAST21
Topological domaini264 – 288CytoplasmicSequence analysisAdd BLAST25

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi941
OpenTargetsiENSG00000121594
PharmGKBiPA26239

Chemistry databases

ChEMBLiCHEMBL2364157
DrugBankiDB01281 Abatacept
DB06681 Belatacept
DB04901 Galiximab
GuidetoPHARMACOLOGYi2744

Polymorphism and mutation databases

BioMutaiCD80
DMDMi461606

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 341 PublicationAdd BLAST34
ChainiPRO_000001454735 – 288T-lymphocyte activation antigen CD80Add BLAST254

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi50 ↔ 116PROSITE-ProRule annotation1 Publication
Glycosylationi53N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi89N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi98N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi162 ↔ 216PROSITE-ProRule annotation1 Publication
Glycosylationi186N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi207N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi211N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi226N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi232N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei284PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP33681
PeptideAtlasiP33681
PRIDEiP33681
ProteomicsDBi54922

PTM databases

iPTMnetiP33681
PhosphoSitePlusiP33681

Expressioni

Tissue specificityi

Expressed on activated B-cells, macrophages and dendritic cells.

Gene expression databases

BgeeiENSG00000121594
CleanExiHS_CD80
ExpressionAtlasiP33681 baseline and differential
GenevisibleiP33681 HS

Organism-specific databases

HPAiCAB025368
HPA050092

Interactioni

Subunit structurei

Homodimer; CD80 dimers on the antigen presenting cells (APCs) bridge CTLA4/CD152 dimers on T-cells in a periodic zipper-like arrangement.2 Publications
(Microbial infection) Interacts with adenovirus subgroup B fiber proteins.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi107379, 75 interactors
DIPiDIP-6044N
IntActiP33681, 5 interactors
STRINGi9606.ENSP00000264246

Structurei

Secondary structure

1288
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi37 – 41Combined sources5
Beta strandi46 – 48Combined sources3
Helixi58 – 61Combined sources4
Beta strandi63 – 68Combined sources6
Beta strandi71 – 77Combined sources7
Beta strandi80 – 83Combined sources4
Helixi85 – 88Combined sources4
Beta strandi91 – 95Combined sources5
Turni96 – 99Combined sources4
Beta strandi100 – 103Combined sources4
Helixi108 – 110Combined sources3
Beta strandi112 – 120Combined sources9
Beta strandi127 – 139Combined sources13
Beta strandi146 – 151Combined sources6
Beta strandi157 – 169Combined sources13
Beta strandi171 – 179Combined sources9
Beta strandi185 – 191Combined sources7
Turni193 – 195Combined sources3
Beta strandi198 – 207Combined sources10
Beta strandi212 – 220Combined sources9
Beta strandi225 – 231Combined sources7

3D structure databases

ProteinModelPortaliP33681
SMRiP33681
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP33681

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 135Ig-like V-typeAdd BLAST101
Domaini145 – 230Ig-like C2-typeAdd BLAST86

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J3XE Eukaryota
ENOG411154Z LUCA
GeneTreeiENSGT00720000108819
HOGENOMiHOG000036959
HOVERGENiHBG000261
InParanoidiP33681
KOiK05412
OMAiVRIYWQK
OrthoDBiEOG091G0QRI
PhylomeDBiP33681
TreeFamiTF351094

Family and domain databases

CDDicd16083 IgC_CD80, 1 hit
Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR013162 CD80_C2-set
IPR037676 CD80_IgC
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
PfamiView protein in Pfam
PF08205 C2-set_2, 1 hit
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 2 hits

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P33681-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGHTRRQGTS PSKCPYLNFF QLLVLAGLSH FCSGVIHVTK EVKEVATLSC
60 70 80 90 100
GHNVSVEELA QTRIYWQKEK KMVLTMMSGD MNIWPEYKNR TIFDITNNLS
110 120 130 140 150
IVILALRPSD EGTYECVVLK YEKDAFKREH LAEVTLSVKA DFPTPSISDF
160 170 180 190 200
EIPTSNIRRI ICSTSGGFPE PHLSWLENGE ELNAINTTVS QDPETELYAV
210 220 230 240 250
SSKLDFNMTT NHSFMCLIKY GHLRVNQTFN WNTTKQEHFP DNLLPSWAIT
260 270 280
LISVNGIFVI CCLTYCFAPR CRERRRNERL RRESVRPV
Length:288
Mass (Da):33,048
Last modified:February 1, 1994 - v1
Checksum:iBA453EE34528B1F4
GO
Isoform 2 (identifier: P33681-2) [UniParc]FASTAAdd to basket
Also known as: s1CD80

The sequence of this isoform differs from the canonical sequence as follows:
     234-266: TKQEHFPDNLLPSWAITLISVNGIFVICCLTYC → S

Note: Soluble isoform. Expressed in unstimulated B-cells and monocytes, but not T-cells.
Show »
Length:256
Mass (Da):29,413
Checksum:iDEB0A9FBA7B7D9A4
GO
Isoform 3 (identifier: P33681-3) [UniParc]FASTAAdd to basket
Also known as: s2CD80

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: A → G
     141-266: Missing.

Note: Soluble isoform. Expressed in T-cells activated by ConA, non-activated monocytes and monocytes activated with IFN-c.
Show »
Length:162
Mass (Da):18,761
Checksum:i24DBC2D5BD70C4FA
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_047698140A → G in isoform 3. 1 Publication1
Alternative sequenceiVSP_047699141 – 266Missing in isoform 3. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_047700234 – 266TKQEH…CLTYC → S in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M27533 mRNA Translation: AAA36045.1
M83077
, M83072, M83073, M83074 Genomic DNA Translation: AAA58390.1
AY197777 mRNA Translation: AAO39208.1
AY197778 mRNA Translation: AAO39209.1
AC073352 Genomic DNA No translation available.
BC042665 mRNA Translation: AAH42665.1
CCDSiCCDS2989.1 [P33681-1]
PIRiI54495 A45803
RefSeqiNP_005182.1, NM_005191.3 [P33681-1]
UniGeneiHs.838

Genome annotation databases

EnsembliENST00000264246; ENSP00000264246; ENSG00000121594 [P33681-1]
ENST00000383669; ENSP00000373165; ENSG00000121594 [P33681-2]
ENST00000478182; ENSP00000418364; ENSG00000121594 [P33681-1]
GeneIDi941
KEGGihsa:941
UCSCiuc003ecq.4 human [P33681-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCD80_HUMAN
AccessioniPrimary (citable) accession number: P33681
Secondary accession number(s): Q5DTA9, Q5DTB0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: June 20, 2018
This is version 182 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health