Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Guanylate cyclase soluble subunit alpha-2

Gene

GUCY1A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has guanylyl cyclase on binding to the beta-1 subunit.
Isoform 2 acts as a negative regulator of guanylyl cyclase activity as it forms non-functional heterodimers with the beta subunits.

Miscellaneous

There are two types of guanylate cyclases: soluble forms and membrane-associated receptor forms.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by nitric oxide in the presence of magnesium or manganese ions.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTP binding Source: UniProtKB-KW
  • guanylate cyclase activity Source: ProtInc
  • heme binding Source: InterPro

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase
Biological processcGMP biosynthesis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
4.6.1.2 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-392154 Nitric oxide stimulates guanylate cyclase

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P33402

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Guanylate cyclase soluble subunit alpha-2 (EC:4.6.1.2)
Short name:
GCS-alpha-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GUCY1A2
Synonyms:GUC1A2, GUCSA2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000152402.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4684 GUCY1A2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601244 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P33402

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
2977

Open Targets

More...
OpenTargetsi
ENSG00000152402

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA186

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2111348

Drug and drug target database

More...
DrugBanki
DB01020 Isosorbide Mononitrate
DB09241 Methylene blue
DB00435 Nitric Oxide
DB13170 Plecanatide
DB08931 Riociguat

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GUCY1A2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
461897

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000741131 – 732Guanylate cyclase soluble subunit alpha-2Add BLAST732

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P33402

PeptideAtlas

More...
PeptideAtlasi
P33402

PRoteomics IDEntifications database

More...
PRIDEi
P33402

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54910
54911 [P33402-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P33402

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P33402

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in fetal brain, liver, colon, endothelium and testis. Isoform 2 is expressed only in liver, colon and endothelium.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000152402 Expressed in 189 organ(s), highest expression level in myometrium

CleanEx database of gene expression profiles

More...
CleanExi
HS_GUCY1A2

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P33402 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB009534

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta chain.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109232, 12 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P33402

Protein interaction database and analysis system

More...
IntActi
P33402, 7 interactors

Molecular INTeraction database

More...
MINTi
P33402

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000431245

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P33402

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P33402

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini521 – 648Guanylate cyclasePROSITE-ProRule annotationAdd BLAST128

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi51 – 76Ala-richAdd BLAST26
Compositional biasi51 – 58Poly-Ala8

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4171 Eukaryota
COG2114 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157765

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220903

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106603

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P33402

KEGG Orthology (KO)

More...
KOi
K12318

Identification of Orthologs from Complete Genome Data

More...
OMAi
QNWPNIH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04KV

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P33402

TreeFam database of animal gene trees

More...
TreeFami
TF351403

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.1230, 1 hit
3.90.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001054 A/G_cyclase
IPR018297 A/G_cyclase_CS
IPR038158 H-NOX_domain_sf
IPR011644 Heme_NO-bd
IPR011645 HNOB_dom_associated
IPR024096 NO_sig/Golgi_transp_ligand-bd
IPR029787 Nucleotide_cyclase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00211 Guanylate_cyc, 1 hit
PF07700 HNOB, 1 hit
PF07701 HNOBA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00044 CYCc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111126 SSF111126, 1 hit
SSF55073 SSF55073, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00452 GUANYLATE_CYCLASE_1, 1 hit
PS50125 GUANYLATE_CYCLASE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P33402-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRRKISSES FSSLGSDYLE TSPEEEGECP LSRLCWNGSR SPPGPLEPSP
60 70 80 90 100
AAAAAAAAPA PTPAASAAAA AATAGARRVQ RRRRVNLDSL GESISRLTAP
110 120 130 140 150
SPQTIQQTLK RTLQYYEHQV IGYRDAEKNF HNISNRCSYA DHSNKEEIED
160 170 180 190 200
VSGILQCTAN ILGLKFEEIQ KRFGEEFFNI CFHENERVLR AVGGTLQDFF
210 220 230 240 250
NGFDALLEHI RTSFGKQATL ESPSFLCKEL PEGTLMLHYF HPHHIVGFAM
260 270 280 290 300
LGMIKAAGKK IYRLDVEVEQ VANEKLCSDV SNPGNCSCLT FLIKECENTN
310 320 330 340 350
IMKNLPQGTS QVPADLRISI NTFCRAFPFH LMFDPSMSVL QLGEGLRKQL
360 370 380 390 400
RCDTHKVLKF EDCFEIVSPK VNATFERVLL RLSTPFVIRT KPEASGSENK
410 420 430 440 450
DKVMEVKGQM IHVPESNSIL FLGSPCVDKL DELMGRGLHL SDIPIHDATR
460 470 480 490 500
DVILVGEQAK AQDGLKKRMD KLKATLERTH QALEEEKKKT VDLLYSIFPG
510 520 530 540 550
DVAQQLWQGQ QVQARKFDDV TMLFSDIVGF TAICAQCTPM QVISMLNELY
560 570 580 590 600
TRFDHQCGFL DIYKVETIGD AYCVAAGLHR KSLCHAKPIA LMALKMMELS
610 620 630 640 650
EEVLTPDGRP IQMRIGIHSG SVLAGVVGVR MPRYCLFGNN VTLASKFESG
660 670 680 690 700
SHPRRINVSP TTYQLLKREE SFTFIPRSRE ELPDNFPKEI PGICYFLEVR
710 720 730
TGPKPPKPSL SSSRIKKVSY NIGTMFLRET SL
Length:732
Mass (Da):81,750
Last modified:February 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i79465A7D3FE52DB7
GO
Isoform 2 (identifier: P33402-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-2-I

The sequence of this isoform differs from the canonical sequence as follows:
     612-612: Q → QPQRSELLFSFPVSIQLVPDQHQSETDLGTEK

Show »
Length:763
Mass (Da):85,259
Checksum:iE3493CCC508BE6EB
GO
Isoform 3 (identifier: P33402-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-402: K → KSKHVTEGHLTQLSVAGFNSLE

Note: No experimental confirmation available.
Show »
Length:753
Mass (Da):83,986
Checksum:i447CF8A2C77F249D
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036420681E → V in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_036421685N → T in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_054154402K → KSKHVTEGHLTQLSVAGFNS LE in isoform 3. 1 Publication1
Alternative sequenceiVSP_001814612Q → QPQRSELLFSFPVSIQLVPD QHQSETDLGTEK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X63282 mRNA Translation: CAA44921.1
Z50053 mRNA Translation: CAA90393.1
AP001282 Genomic DNA No translation available.
AP001881 Genomic DNA No translation available.
AP003078 Genomic DNA No translation available.
AP005014 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67081.1
BC130484 mRNA Translation: AAI30485.1
BC130488 mRNA Translation: AAI30489.1
BC144033 mRNA Translation: AAI44034.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58170.1 [P33402-2]
CCDS8335.1 [P33402-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S18325

NCBI Reference Sequences

More...
RefSeqi
NP_000846.1, NM_000855.2 [P33402-1]
NP_001243353.1, NM_001256424.1 [P33402-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.24321

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000282249; ENSP00000282249; ENSG00000152402 [P33402-2]
ENST00000347596; ENSP00000344874; ENSG00000152402 [P33402-3]
ENST00000526355; ENSP00000431245; ENSG00000152402 [P33402-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2977

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2977

UCSC genome browser

More...
UCSCi
uc001pjf.6 human [P33402-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63282 mRNA Translation: CAA44921.1
Z50053 mRNA Translation: CAA90393.1
AP001282 Genomic DNA No translation available.
AP001881 Genomic DNA No translation available.
AP003078 Genomic DNA No translation available.
AP005014 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67081.1
BC130484 mRNA Translation: AAI30485.1
BC130488 mRNA Translation: AAI30489.1
BC144033 mRNA Translation: AAI44034.1
CCDSiCCDS58170.1 [P33402-2]
CCDS8335.1 [P33402-1]
PIRiS18325
RefSeqiNP_000846.1, NM_000855.2 [P33402-1]
NP_001243353.1, NM_001256424.1 [P33402-2]
UniGeneiHs.24321

3D structure databases

ProteinModelPortaliP33402
SMRiP33402
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109232, 12 interactors
CORUMiP33402
IntActiP33402, 7 interactors
MINTiP33402
STRINGi9606.ENSP00000431245

Chemistry databases

ChEMBLiCHEMBL2111348
DrugBankiDB01020 Isosorbide Mononitrate
DB09241 Methylene blue
DB00435 Nitric Oxide
DB13170 Plecanatide
DB08931 Riociguat

PTM databases

iPTMnetiP33402
PhosphoSitePlusiP33402

Polymorphism and mutation databases

BioMutaiGUCY1A2
DMDMi461897

Proteomic databases

PaxDbiP33402
PeptideAtlasiP33402
PRIDEiP33402
ProteomicsDBi54910
54911 [P33402-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282249; ENSP00000282249; ENSG00000152402 [P33402-2]
ENST00000347596; ENSP00000344874; ENSG00000152402 [P33402-3]
ENST00000526355; ENSP00000431245; ENSG00000152402 [P33402-1]
GeneIDi2977
KEGGihsa:2977
UCSCiuc001pjf.6 human [P33402-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2977
DisGeNETi2977
EuPathDBiHostDB:ENSG00000152402.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GUCY1A2
HGNCiHGNC:4684 GUCY1A2
HPAiCAB009534
MIMi601244 gene
neXtProtiNX_P33402
OpenTargetsiENSG00000152402
PharmGKBiPA186

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4171 Eukaryota
COG2114 LUCA
GeneTreeiENSGT00940000157765
HOGENOMiHOG000220903
HOVERGENiHBG106603
InParanoidiP33402
KOiK12318
OMAiQNWPNIH
OrthoDBiEOG091G04KV
PhylomeDBiP33402
TreeFamiTF351403

Enzyme and pathway databases

BRENDAi4.6.1.2 2681
ReactomeiR-HSA-392154 Nitric oxide stimulates guanylate cyclase
SIGNORiP33402

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GUCY1A2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GUCY1A2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2977

Protein Ontology

More...
PROi
PR:P33402

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000152402 Expressed in 189 organ(s), highest expression level in myometrium
CleanExiHS_GUCY1A2
GenevisibleiP33402 HS

Family and domain databases

Gene3Di3.30.70.1230, 1 hit
3.90.1520.10, 1 hit
InterProiView protein in InterPro
IPR001054 A/G_cyclase
IPR018297 A/G_cyclase_CS
IPR038158 H-NOX_domain_sf
IPR011644 Heme_NO-bd
IPR011645 HNOB_dom_associated
IPR024096 NO_sig/Golgi_transp_ligand-bd
IPR029787 Nucleotide_cyclase
PfamiView protein in Pfam
PF00211 Guanylate_cyc, 1 hit
PF07700 HNOB, 1 hit
PF07701 HNOBA, 1 hit
SMARTiView protein in SMART
SM00044 CYCc, 1 hit
SUPFAMiSSF111126 SSF111126, 1 hit
SSF55073 SSF55073, 1 hit
PROSITEiView protein in PROSITE
PS00452 GUANYLATE_CYCLASE_1, 1 hit
PS50125 GUANYLATE_CYCLASE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGCYA2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P33402
Secondary accession number(s): A1L4C4, B7ZLT5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: December 5, 2018
This is version 167 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again