Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P33402 (GCYA2_HUMAN)

Entry version 184 (02 Jun 2021)
Sequence version 1 (01 Feb 1994)
Previous versions | rss
Add a publicationFeedback
Protein

Guanylate cyclase soluble subunit alpha-2

Gene

GUCY1A2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has guanylyl cyclase on binding to the beta-1 subunit.

Isoform 2 acts as a negative regulator of guanylyl cyclase activity as it forms non-functional heterodimers with the beta subunits.

Miscellaneous

There are two types of guanylate cyclases: soluble forms and membrane-associated receptor forms.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by nitric oxide in the presence of magnesium or manganese ions.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase
Biological processcGMP biosynthesis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		4.6.1.2, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P33402

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-392154, Nitric oxide stimulates guanylate cyclase
R-HSA-445355, Smooth Muscle Contraction

SIGNOR Signaling Network Open Resource

More...SIGNORi		P33402

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Guanylate cyclase soluble subunit alpha-2 (EC:4.6.1.2)
Short name:
GCS-alpha-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GUCY1A2
Synonyms:GUC1A2, GUCSA2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:4684, GUCY1A2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601244, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P33402

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000152402.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		2977

Open Targets

More...OpenTargetsi		ENSG00000152402

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA186

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P33402, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2111348

Drug and drug target database

More...DrugBanki		DB01020, Isosorbide mononitrate
DB13749, Magnesium gluconate
DB09241, Methylene blue
DB09282, Molsidomine
DB00435, Nitric Oxide
DB06154, Pentaerythritol tetranitrate
DB13170, Plecanatide
DB08931, Riociguat

DrugCentral

More...DrugCentrali		P33402

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GUCY1A2

Domain mapping of disease mutations (DMDM)

More...DMDMi		461897

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000741131 – 732Guanylate cyclase soluble subunit alpha-2Add BLAST732

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P33402

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P33402

PeptideAtlas

More...PeptideAtlasi		P33402

PRoteomics IDEntifications database

More...PRIDEi		P33402

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54910 [P33402-1]
54911 [P33402-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P33402

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P33402

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in fetal brain, liver, colon, endothelium and testis. Isoform 2 is expressed only in liver, colon and endothelium.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000152402, Expressed in myometrium and 207 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P33402, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000152402, Tissue enhanced (endometrium, placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of an alpha and a beta chain.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109232, 13 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P33402

Protein interaction database and analysis system

More...IntActi		P33402, 8 interactors

Molecular INTeraction database

More...MINTi		P33402

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000282249

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P33402, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P33402

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini521 – 648Guanylate cyclasePROSITE-ProRule annotationAdd BLAST128

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 58DisorderedSequence analysisAdd BLAST58

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 19Polar residuesSequence analysisAdd BLAST19

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4171, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157765

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_011614_5_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P33402

Identification of Orthologs from Complete Genome Data

More...OMAi		QNWPNIH

Database of Orthologous Groups

More...OrthoDBi		531253at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P33402

TreeFam database of animal gene trees

More...TreeFami		TF351403

Family and domain databases

Conserved Domains Database

More...CDDi		cd07302, CHD, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.450.260, 1 hit
3.30.70.1230, 1 hit
3.90.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001054, A/G_cyclase
IPR018297, A/G_cyclase_CS
IPR038158, H-NOX_domain_sf
IPR011644, Heme_NO-bd
IPR011645, HNOB_dom_associated
IPR042463, HNOB_dom_associated_sf
IPR024096, NO_sig/Golgi_transp_ligand-bd
IPR029787, Nucleotide_cyclase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00211, Guanylate_cyc, 1 hit
PF07700, HNOB, 1 hit
PF07701, HNOBA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00044, CYCc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF111126, SSF111126, 1 hit
SSF55073, SSF55073, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00452, GUANYLATE_CYCLASE_1, 1 hit
PS50125, GUANYLATE_CYCLASE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P33402-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRRKISSES FSSLGSDYLE TSPEEEGECP LSRLCWNGSR SPPGPLEPSP 
        60         70         80         90        100
AAAAAAAAPA PTPAASAAAA AATAGARRVQ RRRRVNLDSL GESISRLTAP 
       110        120        130        140        150
SPQTIQQTLK RTLQYYEHQV IGYRDAEKNF HNISNRCSYA DHSNKEEIED 
       160        170        180        190        200
VSGILQCTAN ILGLKFEEIQ KRFGEEFFNI CFHENERVLR AVGGTLQDFF 
       210        220        230        240        250
NGFDALLEHI RTSFGKQATL ESPSFLCKEL PEGTLMLHYF HPHHIVGFAM 
       260        270        280        290        300
LGMIKAAGKK IYRLDVEVEQ VANEKLCSDV SNPGNCSCLT FLIKECENTN 
       310        320        330        340        350
IMKNLPQGTS QVPADLRISI NTFCRAFPFH LMFDPSMSVL QLGEGLRKQL 
       360        370        380        390        400
RCDTHKVLKF EDCFEIVSPK VNATFERVLL RLSTPFVIRT KPEASGSENK 
       410        420        430        440        450
DKVMEVKGQM IHVPESNSIL FLGSPCVDKL DELMGRGLHL SDIPIHDATR 
       460        470        480        490        500
DVILVGEQAK AQDGLKKRMD KLKATLERTH QALEEEKKKT VDLLYSIFPG 
       510        520        530        540        550
DVAQQLWQGQ QVQARKFDDV TMLFSDIVGF TAICAQCTPM QVISMLNELY 
       560        570        580        590        600
TRFDHQCGFL DIYKVETIGD AYCVAAGLHR KSLCHAKPIA LMALKMMELS 
       610        620        630        640        650
EEVLTPDGRP IQMRIGIHSG SVLAGVVGVR MPRYCLFGNN VTLASKFESG 
       660        670        680        690        700
SHPRRINVSP TTYQLLKREE SFTFIPRSRE ELPDNFPKEI PGICYFLEVR 
       710        720        730 
TGPKPPKPSL SSSRIKKVSY NIGTMFLRET SL
Length:732
Mass (Da):81,750
Last modified:February 1, 1994 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i79465A7D3FE52DB7
GO
Isoform 2 (identifier: P33402-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-2-I

The sequence of this isoform differs from the canonical sequence as follows:
     612-612: Q → QPQRSELLFSFPVSIQLVPDQHQSETDLGTEK

Show »
Length:763
Mass (Da):85,259
Checksum:iE3493CCC508BE6EB
GO
Isoform 3 (identifier: P33402-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     402-402: K → KSKHVTEGHLTQLSVAGFNSLE

Show »
Length:753
Mass (Da):83,986
Checksum:i447CF8A2C77F249D
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036420681E → V in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_036421685N → T in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_054154402K → KSKHVTEGHLTQLSVAGFNS LE in isoform 3. 1 Publication1
Alternative sequenceiVSP_001814612Q → QPQRSELLFSFPVSIQLVPD QHQSETDLGTEK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X63282 mRNA Translation: CAA44921.1
Z50053 mRNA Translation: CAA90393.1
AP001282 Genomic DNA No translation available.
AP001881 Genomic DNA No translation available.
AP003078 Genomic DNA No translation available.
AP005014 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67081.1
BC130484 mRNA Translation: AAI30485.1
BC130488 mRNA Translation: AAI30489.1
BC144033 mRNA Translation: AAI44034.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS58170.1 [P33402-2]
CCDS8335.1 [P33402-1]

Protein sequence database of the Protein Information Resource

More...PIRi		S18325

NCBI Reference Sequences

More...RefSeqi		NP_000846.1, NM_000855.2 [P33402-1]
NP_001243353.1, NM_001256424.1 [P33402-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000282249; ENSP00000282249; ENSG00000152402 [P33402-2]
ENST00000347596; ENSP00000344874; ENSG00000152402 [P33402-3]
ENST00000526355; ENSP00000431245; ENSG00000152402 [P33402-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2977

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2977

UCSC genome browser

More...UCSCi		uc001pjf.6, human [P33402-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X63282 mRNA Translation: CAA44921.1
Z50053 mRNA Translation: CAA90393.1
AP001282 Genomic DNA No translation available.
AP001881 Genomic DNA No translation available.
AP003078 Genomic DNA No translation available.
AP005014 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67081.1
BC130484 mRNA Translation: AAI30485.1
BC130488 mRNA Translation: AAI30489.1
BC144033 mRNA Translation: AAI44034.1
CCDSiCCDS58170.1 [P33402-2]
CCDS8335.1 [P33402-1]
PIRiS18325
RefSeqiNP_000846.1, NM_000855.2 [P33402-1]
NP_001243353.1, NM_001256424.1 [P33402-2]

3D structure databases

SMRiP33402
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi109232, 13 interactors
CORUMiP33402
IntActiP33402, 8 interactors
MINTiP33402
STRINGi9606.ENSP00000282249

Chemistry databases

ChEMBLiCHEMBL2111348
DrugBankiDB01020, Isosorbide mononitrate
DB13749, Magnesium gluconate
DB09241, Methylene blue
DB09282, Molsidomine
DB00435, Nitric Oxide
DB06154, Pentaerythritol tetranitrate
DB13170, Plecanatide
DB08931, Riociguat
DrugCentraliP33402

PTM databases

iPTMnetiP33402
PhosphoSitePlusiP33402

Genetic variation databases

BioMutaiGUCY1A2
DMDMi461897

Proteomic databases

MassIVEiP33402
PaxDbiP33402
PeptideAtlasiP33402
PRIDEiP33402
ProteomicsDBi54910 [P33402-1]
54911 [P33402-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4028, 129 antibodies

The DNASU plasmid repository

More...DNASUi		2977

Genome annotation databases

EnsembliENST00000282249; ENSP00000282249; ENSG00000152402 [P33402-2]
ENST00000347596; ENSP00000344874; ENSG00000152402 [P33402-3]
ENST00000526355; ENSP00000431245; ENSG00000152402 [P33402-1]
GeneIDi2977
KEGGihsa:2977
UCSCiuc001pjf.6, human [P33402-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2977
DisGeNETi2977

GeneCards: human genes, protein and diseases

More...GeneCardsi		GUCY1A2
HGNCiHGNC:4684, GUCY1A2
HPAiENSG00000152402, Tissue enhanced (endometrium, placenta)
MIMi601244, gene
neXtProtiNX_P33402
OpenTargetsiENSG00000152402
PharmGKBiPA186
VEuPathDBiHostDB:ENSG00000152402.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4171, Eukaryota
GeneTreeiENSGT00940000157765
HOGENOMiCLU_011614_5_0_1
InParanoidiP33402
OMAiQNWPNIH
OrthoDBi531253at2759
PhylomeDBiP33402
TreeFamiTF351403

Enzyme and pathway databases

BRENDAi4.6.1.2, 2681
PathwayCommonsiP33402
ReactomeiR-HSA-392154, Nitric oxide stimulates guanylate cyclase
R-HSA-445355, Smooth Muscle Contraction
SIGNORiP33402

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2977, 4 hits in 987 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GUCY1A2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		GUCY1A2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2977
PharosiP33402, Tclin

Protein Ontology

More...PROi		PR:P33402
RNActiP33402, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000152402, Expressed in myometrium and 207 other tissues
GenevisibleiP33402, HS

Family and domain databases

CDDicd07302, CHD, 1 hit
Gene3Di3.30.450.260, 1 hit
3.30.70.1230, 1 hit
3.90.1520.10, 1 hit
InterProiView protein in InterPro
IPR001054, A/G_cyclase
IPR018297, A/G_cyclase_CS
IPR038158, H-NOX_domain_sf
IPR011644, Heme_NO-bd
IPR011645, HNOB_dom_associated
IPR042463, HNOB_dom_associated_sf
IPR024096, NO_sig/Golgi_transp_ligand-bd
IPR029787, Nucleotide_cyclase
PfamiView protein in Pfam
PF00211, Guanylate_cyc, 1 hit
PF07700, HNOB, 1 hit
PF07701, HNOBA, 1 hit
SMARTiView protein in SMART
SM00044, CYCc, 1 hit
SUPFAMiSSF111126, SSF111126, 1 hit
SSF55073, SSF55073, 1 hit
PROSITEiView protein in PROSITE
PS00452, GUANYLATE_CYCLASE_1, 1 hit
PS50125, GUANYLATE_CYCLASE_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGCYA2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P33402
Secondary accession number(s): A1L4C4, B7ZLT5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1994
Last sequence update: February 1, 1994
Last modified: June 2, 2021
This is version 184 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again