Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (02 Jun 2021)
Sequence version 3 (01 Dec 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Innexin shaking-B

Gene

shakB

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Structural component of the gap junctions at electrical synapses in distal and mid-depth levels in the lamina. Isoform Lethal forms voltage sensitive intercellular channels through homotypic interactions.

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel
Biological processBehavior, Ion transport, Transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.25.1.4, the gap junction-forming innexin (innexin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Innexin shaking-B
Alternative name(s):
Protein passover
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:shakB
Synonyms:Pas, shak-B
ORF Names:CG34358
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0085387, shakB

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 21CytoplasmicSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei22 – 42HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini43 – 110ExtracellularSequence analysisAdd BLAST68
Transmembranei111 – 131HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini132 – 182CytoplasmicSequence analysisAdd BLAST51
Transmembranei183 – 203HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini204 – 267ExtracellularSequence analysisAdd BLAST64
Transmembranei268 – 288HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini289 – 372CytoplasmicSequence analysisAdd BLAST84

Keywords - Cellular componenti

Cell junction, Cell membrane, Gap junction, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Flies fail to jump in response to a light-off stimulus. Neural-specific mutants exhibit modified giant fiber system and gustatory response.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002085001 – 372Innexin shaking-BAdd BLAST372

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform Neural is expressed in synapses of giant fibers (GF), in a large thoracic cell in location of postsynaptic target and optic lobe lamina and medulla. Isoform Lethal is expressed in embryonic mesodermal derivatives. During metamorphosis, both isoforms are dynamically expressed in pupal nervous system.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0085387, Expressed in central nervous system and 39 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P33085, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P33085, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (isoform Lethal).

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
59350, 6 interactors

Protein interaction database and analysis system

More...
IntActi
P33085, 1 interactor

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0111481

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P33085

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the pannexin family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QWRS, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_035763_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P33085

Identification of Orthologs from Complete Genome Data

More...
OMAi
WHSGINL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P33085

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000990, Innexin

The PANTHER Classification System

More...
PANTHERi
PTHR11893, PTHR11893, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00876, Innexin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01262, INNEXIN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51013, PANNEXIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform Lethal (identifier: P33085-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLDIFRGLKN LVKVSHVKTD SIVFRLHYSI TVMILMSFSL IITTRQYVGN
60 70 80 90 100
PIDCVHTKDI PEDVLNTYCW IQSTYTLKSL FLKKQGVSVP YPGIGNSDGD
110 120 130 140 150
PADKKHYKYY QWVCFCLFFQ AILFYTPRWL WKSWEGGKIH ALIMDLDIGI
160 170 180 190 200
CSEAEKKQKK KLLLDYLWEN LRYHNWWAYR YYVCELLALI NVIGQMFLMN
210 220 230 240 250
RFFDGEFITF GLKVIDYMET DQEDRMDPMI YIFPRMTKCT FFKYGSSGEV
260 270 280 290 300
EKHDAICILP LNVVNEKIYI FLWFWFILLT FLTLLTLIYR VVIIFSPRMR
310 320 330 340 350
VYLFRMRFRL VRRDAIEIIV RRSKMGDWFL LYLLGENIDT VIFRDVVQDL
360 370
ANRLGHNQHH RVPGLKGEIQ DA
Length:372
Mass (Da):44,355
Last modified:December 1, 2000 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3DD1049D8F1D4481
GO
Isoform Neural (identifier: P33085-2) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     2-58: LDIFRGLKNL...GNPIDCVHTK → VSHVKIDSPV...GNPIDCVHTR
     72-116: QSTYTLKSLF...YKYYQWVCFC → HSTYTVVDAF...TKYYQWVAFT

Show »
Length:361
Mass (Da):42,904
Checksum:iB914B25C8D6E8DD5
GO
Isoform B (identifier: P33085-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-121: A → P
     123-372: Missing.

Show »
Length:122
Mass (Da):14,147
Checksum:iD71A9AC29FB0A361
GO
Isoform D (identifier: P33085-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-116: LDIFRGLKNL...YKYYQWVCFC → YKPDTLTRRG...TKYYQWVAFT

Show »
Length:532
Mass (Da):61,391
Checksum:i3C517141DBCE54EA
GO
Isoform E (identifier: P33085-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-119: LDIFRGLKNL...YQWVCFCLFF → MGRHCHVPKQ...QKKIPTTYNE

Show »
Length:316
Mass (Da):37,711
Checksum:i2124C91421ADF507
GO
Isoform F (identifier: P33085-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-36: LDIFRGLKNLVKVSHVKTDSIVFRLHYSITVMILM → KKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFT
     37-116: Missing.

Show »
Length:292
Mass (Da):35,073
Checksum:i2BEC859714E49365
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9NGR8M9NGR8_DROME
Innexin
shakB 2, 3, 6, CG12678, CG1321
377Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti232I → M in AAA28745 (PubMed:8500183).Curated1
Sequence conflicti232I → M in ABE73233 (Ref. 7) Curated1
Sequence conflicti247 – 249SGE → GEV in AAC46584 (PubMed:7892218).Curated3
Isoform D (identifier: P33085-4)
Sequence conflicti3K → E in ABE73233 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0374742 – 119LDIFR…FCLFF → MGRHCHVPKQTHHIQFAQLA QSPAVCGLSESAANLRYKLL LICHRVGIKIPRQKKIPTTY NE in isoform E. CuratedAdd BLAST118
Alternative sequenceiVSP_0369132 – 116LDIFR…WVCFC → YKPDTLTRRGSLRSLRSAPL LSTVLESTLSLTRIHPIASL ELPGLDYAVHSQSAFGAYGL AHPRDLATCTSLRSGLAAIT AASASAAGGVSQSQSALLGR YGPNASIRHGERKIVQPKRV LSRKLKPHLVADTVKQYISR AQRTTKKGSQEQQNMEFLRG VYAFMQVSRSSVSHVKIDSP VFRLHTNATVILLITFSIAV TTRQYVGNPIDCVHTRDIPE DVLNTYCWIHSTYTVVDAFM KKQGSEVPFPGVHNSQGRGP LTIKHTKYYQWVAFT in isoform D. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_0026782 – 58LDIFR…CVHTK → VSHVKIDSPVFRLHTNATVI LLITFSIAVTTRQYVGNPID CVHTR in isoform Neural. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_0369142 – 36LDIFR…VMILM → KKQGSEVPFPGVHNSQGRGP LTIKHTKYYQWVAFT in isoform F. CuratedAdd BLAST35
Alternative sequenceiVSP_03691537 – 116Missing in isoform F. CuratedAdd BLAST80
Alternative sequenceiVSP_00267972 – 116QSTYT…WVCFC → HSTYTVVDAFMKKQGSEVPF PGVHNSQGRGPLTIKHTKYY QWVAFT in isoform Neural. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_012897121A → P in isoform B. 1 Publication1
Alternative sequenceiVSP_012898123 – 372Missing in isoform B. 1 PublicationAdd BLAST250

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M98872 mRNA Translation: AAA89079.1
X65103 mRNA Translation: CAA46228.1
L13306 mRNA Translation: AAA28745.1
S78495 mRNA Translation: AAB34769.1
U17330 mRNA Translation: AAC46584.1
AE014298 Genomic DNA Translation: AAF50880.2
AE014298 Genomic DNA Translation: AAF50882.2
AE014298 Genomic DNA Translation: AAF50883.1
AE014298 Genomic DNA Translation: ABW09456.2
AE014298 Genomic DNA Translation: ACL82952.1
BT025062 mRNA Translation: ABE73233.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A40734
JN0441

NCBI Reference Sequences

More...
RefSeqi
NP_001097038.2, NM_001103568.3 [P33085-6]
NP_001138222.1, NM_001144750.2 [P33085-5]
NP_523425.2, NM_078701.3 [P33085-2]
NP_608410.2, NM_134566.3 [P33085-4]
NP_728361.1, NM_170660.2 [P33085-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0112569; FBpp0111481; FBgn0085387 [P33085-4]
FBtr0112570; FBpp0111482; FBgn0085387 [P33085-2]
FBtr0112571; FBpp0111483; FBgn0085387 [P33085-1]
FBtr0112572; FBpp0111484; FBgn0085387 [P33085-6]
FBtr0114645; FBpp0113137; FBgn0085387 [P33085-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
33062

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG34358

UCSC genome browser

More...
UCSCi
CG34358-RD, d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M98872 mRNA Translation: AAA89079.1
X65103 mRNA Translation: CAA46228.1
L13306 mRNA Translation: AAA28745.1
S78495 mRNA Translation: AAB34769.1
U17330 mRNA Translation: AAC46584.1
AE014298 Genomic DNA Translation: AAF50880.2
AE014298 Genomic DNA Translation: AAF50882.2
AE014298 Genomic DNA Translation: AAF50883.1
AE014298 Genomic DNA Translation: ABW09456.2
AE014298 Genomic DNA Translation: ACL82952.1
BT025062 mRNA Translation: ABE73233.1
PIRiA40734
JN0441
RefSeqiNP_001097038.2, NM_001103568.3 [P33085-6]
NP_001138222.1, NM_001144750.2 [P33085-5]
NP_523425.2, NM_078701.3 [P33085-2]
NP_608410.2, NM_134566.3 [P33085-4]
NP_728361.1, NM_170660.2 [P33085-1]

3D structure databases

SMRiP33085
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi59350, 6 interactors
IntActiP33085, 1 interactor
STRINGi7227.FBpp0111481

Protein family/group databases

TCDBi1.A.25.1.4, the gap junction-forming innexin (innexin) family

Genome annotation databases

EnsemblMetazoaiFBtr0112569; FBpp0111481; FBgn0085387 [P33085-4]
FBtr0112570; FBpp0111482; FBgn0085387 [P33085-2]
FBtr0112571; FBpp0111483; FBgn0085387 [P33085-1]
FBtr0112572; FBpp0111484; FBgn0085387 [P33085-6]
FBtr0114645; FBpp0113137; FBgn0085387 [P33085-5]
GeneIDi33062
KEGGidme:Dmel_CG34358
UCSCiCG34358-RD, d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
33062
FlyBaseiFBgn0085387, shakB

Phylogenomic databases

eggNOGiENOG502QWRS, Eukaryota
HOGENOMiCLU_035763_1_1_1
InParanoidiP33085
OMAiWHSGINL
PhylomeDBiP33085

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
33062, 0 hits in 1 CRISPR screen

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
shakB, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
33062

Protein Ontology

More...
PROi
PR:P33085

Gene expression databases

BgeeiFBgn0085387, Expressed in central nervous system and 39 other tissues
ExpressionAtlasiP33085, baseline and differential
GenevisibleiP33085, DM

Family and domain databases

InterProiView protein in InterPro
IPR000990, Innexin
PANTHERiPTHR11893, PTHR11893, 1 hit
PfamiView protein in Pfam
PF00876, Innexin, 1 hit
PRINTSiPR01262, INNEXIN
PROSITEiView protein in PROSITE
PS51013, PANNEXIN, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHAKB_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P33085
Secondary accession number(s): A8JUT3
, B7Z104, Q1RKZ8, Q24011, Q24520, Q26432, Q9VRB9, Q9VRC0, Q9VRC2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: December 1, 2000
Last modified: June 2, 2021
This is version 160 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again