Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P32297 (ACHA3_HUMAN)

Entry version 201 (13 Nov 2019)
Sequence version 4 (28 Jul 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neuronal acetylcholine receptor subunit alpha-3

Gene

CHRNA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-629587 Highly sodium permeable acetylcholine nicotinic receptors
R-HSA-629594 Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
R-HSA-629597 Highly calcium permeable nicotinic acetylcholine receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuronal acetylcholine receptor subunit alpha-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CHRNA3
Synonyms:NACHRA3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1957 CHRNA3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		118503 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P32297

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini32 – 240ExtracellularSequence analysisAdd BLAST209
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei241 – 265HelicalSequence analysisAdd BLAST25
Transmembranei273 – 291HelicalSequence analysisAdd BLAST19
Transmembranei307 – 328HelicalSequence analysisAdd BLAST22
Topological domaini329 – 477CytoplasmicSequence analysisAdd BLAST149
Transmembranei478 – 497HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		1136

MalaCards human disease database

More...MalaCardsi		CHRNA3
MIMi612052 phenotype

Open Targets

More...OpenTargetsi		ENSG00000080644

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA113

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P32297

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3068

Drug and drug target database

More...DrugBanki		DB00915 Amantadine
DB01156 Bupropion
DB09028 Cytisine
DB00514 Dextromethorphan
DB07720 Epibatidine
DB00898 Ethanol
DB00472 Fluoxetine
DB00674 Galantamine
DB05710 Gantacurium
DB01227 Levacetylmethadol
DB00848 Levamisole
DB00184 Nicotine
DB01090 Pentolinium
DB01273 Varenicline

DrugCentral

More...DrugCentrali		P32297

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		464

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CHRNA3

Domain mapping of disease mutations (DMDM)

More...DMDMi		254763435

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 31Sequence analysisAdd BLAST31
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000034632 – 505Neuronal acetylcholine receptor subunit alpha-3Add BLAST474

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi55N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi159 ↔ 173By similarity
Glycosylationi172N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi223 ↔ 224Associated with receptor activationBy similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei413PhosphoserineBy similarity1
Modified residuei416PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P32297

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P32297

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P32297

PeptideAtlas

More...PeptideAtlasi		P32297

PRoteomics IDEntifications database

More...PRIDEi		P32297

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54858 [P32297-2]
54859 [P32297-1]
54860 [P32297-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P32297

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P32297

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000080644 Expressed in 125 organ(s), highest expression level in pigmented layer of retina

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P32297 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P32297 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA029430

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Neuronal AChR is composed of two different types of subunits: alpha and beta. Alpha-3 subunit can be combined to beta-2 or beta-4 to give rise to functional receptors.

Interacts with RIC3; which is required for proper folding and assembly (PubMed:16120769).

Interacts with LYPD6 (PubMed:27344019). The heteropentamer alpha-3-beta-2 interacts with alpha-conotoxins ImI and ImII (PubMed:15609996). The heteropentamer alpha-3-beta-2 interacts with alpha-conotoxins ImI, ImII, PnIA, GID and MII (By similarity). The heteropentamer alpha-3-beta-4 interacts with the alpha-conotoxin ImI (PubMed:15609996).

By similarity3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		107558, 31 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-187 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha5-beta2
CPX-210 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha5-beta4
CPX-213 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha6-beta4
CPX-2192 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha6-beta2-beta3
CPX-2193 Neuronal nicotinic acetylcholine receptor complex, alpha3-beta2
CPX-2200 Neuronal nicotinic acetylcholine receptor complex, alpha3-beta4

Protein interaction database and analysis system

More...IntActi		P32297, 31 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000315602

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P32297

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1505
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P32297

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-3/CHRNA3 sub-subfamily. [View classification]Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3645 Eukaryota
ENOG410XQGR LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158487

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P32297

KEGG Orthology (KO)

More...KOi		K04805

Identification of Orthologs from Complete Genome Data

More...OMAi		FWETGEW

Database of Orthologous Groups

More...OrthoDBi		381858at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P32297

TreeFam database of animal gene trees

More...TreeFami		TF315605

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.70.170.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006202 Neur_chan_lig-bd
IPR036734 Neur_chan_lig-bd_sf
IPR006201 Neur_channel
IPR036719 Neuro-gated_channel_TM_sf
IPR006029 Neurotrans-gated_channel_TM
IPR018000 Neurotransmitter_ion_chnl_CS
IPR002394 Nicotinic_acetylcholine_rcpt

The PANTHER Classification System

More...PANTHERi		PTHR18945 PTHR18945, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02931 Neur_chan_LBD, 1 hit
PF02932 Neur_chan_memb, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00254 NICOTINICR
PR00252 NRIONCHANNEL

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF63712 SSF63712, 1 hit
SSF90112 SSF90112, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00860 LIC, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00236 NEUROTR_ION_CHANNEL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 2 (identifier: P32297-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSGPLSLPL ALSPPRLLLL LLLSLLPVAR ASEAEHRLFE RLFEDYNEII 
        60         70         80         90        100
RPVANVSDPV IIHFEVSMSQ LVKVDEVNQI METNLWLKQI WNDYKLKWNP 
       110        120        130        140        150
SDYGGAEFMR VPAQKIWKPD IVLYNNAVGD FQVDDKTKAL LKYTGEVTWI 
       160        170        180        190        200
PPAIFKSSCK IDVTYFPFDY QNCTMKFGSW SYDKAKIDLV LIGSSMNLKD 
       210        220        230        240        250
YWESGEWAII KAPGYKHDIK YNCCEEIYPD ITYSLYIRRL PLFYTINLII 
       260        270        280        290        300
PCLLISFLTV LVFYLPSDCG EKVTLCISVL LSLTVFLLVI TETIPSTSLV 
       310        320        330        340        350
IPLIGEYLLF TMIFVTLSIV ITVFVLNVHY RTPTTHTMPS WVKTVFLNLL 
       360        370        380        390        400
PRVMFMTRPT SNEGNAQKPR PLYGAELSNL NCFSRAESKG CKEGYPCQDG 
       410        420        430        440        450
MCGYCHHRRI KISNFSANLT RSSSSESVDA VLSLSALSPE IKEAIQSVKY 
       460        470        480        490        500
IAENMKAQNE AKEIQDDWKY VAMVIDRIFL WVFTLVCILG TAGLFLQPLM 

AREDA
Length:505
Mass (Da):57,480
Last modified:July 28, 2009 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i478D7712D59ACB2D
GO
Isoform 1 (identifier: P32297-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MGSGPL → MALAV

Show »
Length:504
Mass (Da):57,423
Checksum:iF4D2DA153F2B3476
GO
Isoform 3 (identifier: P32297-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     464-505: IQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA → EQKAQEIQQLKRKEKSTETSDQEPGL

Show »
Length:489
Mass (Da):55,637
Checksum:iF8C4F79BDC30A44E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YNF9H0YNF9_HUMAN
Neuronal acetylcholine receptor sub...
CHRNA3
17Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti5 – 14PLSLPLALSP → ALAAPGAVA in AAA59942 (PubMed:1989896).Curated10
Sequence conflicti12 – 15LSPP → CRA in AAC84176 (PubMed:2336208).Curated4
Sequence conflicti102D → G in AAC84176 (PubMed:2336208).Curated1
Sequence conflicti134 – 135DD → TT in AAC84176 (PubMed:2336208).Curated2
Sequence conflicti237I → S in AAC84176 (PubMed:2336208).Curated1
Sequence conflicti432L → V in AAC84176 (PubMed:2336208).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in CHRNA3 have been associated with susceptibility to smoking-related behavioral traits and lung cancer, contributing to the smoking quantitative trait locus 3 (SQTL3) [MIMi:612052].

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01324023Missing 4 Publications1
Natural variantiVAR_05911037R → H. Corresponds to variant dbSNP:rs8192475Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0377501 – 6MGSGPL → MALAV in isoform 1. 3 Publications6
Alternative sequenceiVSP_037751464 – 505IQDDW…AREDA → EQKAQEIQQLKRKEKSTETS DQEPGL in isoform 3. 2 PublicationsAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M86383 mRNA Translation: AAC84176.1
M37981 mRNA Translation: AAA59942.1
U62432 mRNA Translation: AAB40110.1
Y08418 mRNA Translation: CAA69695.1
AJ007783
, AJ007784, AJ007785, AJ007786, AJ007787 Genomic DNA Translation: CAA07682.1
BT006646 mRNA Translation: AAP35292.1
BT006897 mRNA Translation: AAP35543.1
AC027228 Genomic DNA No translation available.
AC067863 Genomic DNA No translation available.
BC000513 mRNA Translation: AAH00513.1
BC001642 mRNA Translation: AAH01642.1
BC002996 mRNA Translation: AAH02996.1
BC006114 mRNA Translation: AAH06114.1
BC098443 mRNA Translation: AAH98443.1
AF385584 mRNA Translation: AAK68110.1
X53559 mRNA Translation: CAA37625.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10305.1 [P32297-2]
CCDS53964.1 [P32297-3]

Protein sequence database of the Protein Information Resource

More...PIRi		A37040
A53956

NCBI Reference Sequences

More...RefSeqi		NP_000734.2, NM_000743.4 [P32297-2]
NP_001160166.1, NM_001166694.1 [P32297-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000326828; ENSP00000315602; ENSG00000080644 [P32297-2]
ENST00000348639; ENSP00000267951; ENSG00000080644 [P32297-3]
ENST00000559658; ENSP00000452896; ENSG00000080644 [P32297-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1136

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1136

UCSC genome browser

More...UCSCi		uc002beb.4 human [P32297-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86383 mRNA Translation: AAC84176.1
M37981 mRNA Translation: AAA59942.1
U62432 mRNA Translation: AAB40110.1
Y08418 mRNA Translation: CAA69695.1
AJ007783
, AJ007784, AJ007785, AJ007786, AJ007787 Genomic DNA Translation: CAA07682.1
BT006646 mRNA Translation: AAP35292.1
BT006897 mRNA Translation: AAP35543.1
AC027228 Genomic DNA No translation available.
AC067863 Genomic DNA No translation available.
BC000513 mRNA Translation: AAH00513.1
BC001642 mRNA Translation: AAH01642.1
BC002996 mRNA Translation: AAH02996.1
BC006114 mRNA Translation: AAH06114.1
BC098443 mRNA Translation: AAH98443.1
AF385584 mRNA Translation: AAK68110.1
X53559 mRNA Translation: CAA37625.1
CCDSiCCDS10305.1 [P32297-2]
CCDS53964.1 [P32297-3]
PIRiA37040
A53956
RefSeqiNP_000734.2, NM_000743.4 [P32297-2]
NP_001160166.1, NM_001166694.1 [P32297-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ZK4X-ray1.90A/B/C/D/E215-230[»]
5SYOX-ray2.00A/B/C/D/E215-230[»]
5TVCX-ray1.93A/B/C/D/E215-230[»]
6PV7electron microscopy3.34A/D32-378[»]
A/D434-505[»]
6PV8electron microscopy3.87A/D32-378[»]
A/D434-505[»]
SMRiP32297
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi107558, 31 interactors
ComplexPortaliCPX-187 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha5-beta2
CPX-210 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha5-beta4
CPX-213 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha6-beta4
CPX-2192 Neuronal nicotinic acetylcholine receptor complex, alpha3-alpha6-beta2-beta3
CPX-2193 Neuronal nicotinic acetylcholine receptor complex, alpha3-beta2
CPX-2200 Neuronal nicotinic acetylcholine receptor complex, alpha3-beta4
IntActiP32297, 31 interactors
STRINGi9606.ENSP00000315602

Chemistry databases

BindingDBiP32297
ChEMBLiCHEMBL3068
DrugBankiDB00915 Amantadine
DB01156 Bupropion
DB09028 Cytisine
DB00514 Dextromethorphan
DB07720 Epibatidine
DB00898 Ethanol
DB00472 Fluoxetine
DB00674 Galantamine
DB05710 Gantacurium
DB01227 Levacetylmethadol
DB00848 Levamisole
DB00184 Nicotine
DB01090 Pentolinium
DB01273 Varenicline
DrugCentraliP32297
GuidetoPHARMACOLOGYi464

PTM databases

iPTMnetiP32297
PhosphoSitePlusiP32297

Polymorphism and mutation databases

BioMutaiCHRNA3
DMDMi254763435

Proteomic databases

jPOSTiP32297
MassIVEiP32297
PaxDbiP32297
PeptideAtlasiP32297
PRIDEiP32297
ProteomicsDBi54858 [P32297-2]
54859 [P32297-1]
54860 [P32297-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		1136

Genome annotation databases

EnsembliENST00000326828; ENSP00000315602; ENSG00000080644 [P32297-2]
ENST00000348639; ENSP00000267951; ENSG00000080644 [P32297-3]
ENST00000559658; ENSP00000452896; ENSG00000080644 [P32297-2]
GeneIDi1136
KEGGihsa:1136
UCSCiuc002beb.4 human [P32297-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1136
DisGeNETi1136

GeneCards: human genes, protein and diseases

More...GeneCardsi		CHRNA3
HGNCiHGNC:1957 CHRNA3
HPAiHPA029430
MalaCardsiCHRNA3
MIMi118503 gene
612052 phenotype
neXtProtiNX_P32297
OpenTargetsiENSG00000080644
PharmGKBiPA113

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3645 Eukaryota
ENOG410XQGR LUCA
GeneTreeiENSGT00940000158487
InParanoidiP32297
KOiK04805
OMAiFWETGEW
OrthoDBi381858at2759
PhylomeDBiP32297
TreeFamiTF315605

Enzyme and pathway databases

ReactomeiR-HSA-629587 Highly sodium permeable acetylcholine nicotinic receptors
R-HSA-629594 Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
R-HSA-629597 Highly calcium permeable nicotinic acetylcholine receptors

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CHRNA3 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CHRNA3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1136
PharosiP32297

Protein Ontology

More...PROi		PR:P32297

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000080644 Expressed in 125 organ(s), highest expression level in pigmented layer of retina
ExpressionAtlasiP32297 baseline and differential
GenevisibleiP32297 HS

Family and domain databases

Gene3Di2.70.170.10, 1 hit
InterProiView protein in InterPro
IPR006202 Neur_chan_lig-bd
IPR036734 Neur_chan_lig-bd_sf
IPR006201 Neur_channel
IPR036719 Neuro-gated_channel_TM_sf
IPR006029 Neurotrans-gated_channel_TM
IPR018000 Neurotransmitter_ion_chnl_CS
IPR002394 Nicotinic_acetylcholine_rcpt
PANTHERiPTHR18945 PTHR18945, 1 hit
PfamiView protein in Pfam
PF02931 Neur_chan_LBD, 1 hit
PF02932 Neur_chan_memb, 1 hit
PRINTSiPR00254 NICOTINICR
PR00252 NRIONCHANNEL
SUPFAMiSSF63712 SSF63712, 1 hit
SSF90112 SSF90112, 1 hit
TIGRFAMsiTIGR00860 LIC, 1 hit
PROSITEiView protein in PROSITE
PS00236 NEUROTR_ION_CHANNEL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACHA3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P32297
Secondary accession number(s): Q15823
, Q4KMN8, Q86U77, Q96RH3, Q99553, Q9BQ93, Q9BRR4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: July 28, 2009
Last modified: November 13, 2019
This is version 201 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again