Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vasoactive intestinal polypeptide receptor 1

Gene

VIPR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • G protein-coupled peptide receptor activity Source: GO_Central
  • peptide hormone binding Source: GO_Central
  • vasoactive intestinal polypeptide receptor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418555 G alpha (s) signalling events
R-HSA-420092 Glucagon-type ligand receptors

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P32241

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.A.14.4.9 the g-protein-coupled receptor (gpcr) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vasoactive intestinal polypeptide receptor 1
Short name:
VIP-R-1
Alternative name(s):
Pituitary adenylate cyclase-activating polypeptide type II receptor
Short name:
PACAP type II receptor
Short name:
PACAP-R-2
Short name:
PACAP-R2
VPAC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VIPR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000114812.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12694 VIPR1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
192321 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P32241

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini31 – 142ExtracellularSequence analysisAdd BLAST112
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei143 – 167Helical; Name=1Sequence analysisAdd BLAST25
Topological domaini168 – 174CytoplasmicSequence analysis7
Transmembranei175 – 194Helical; Name=2Sequence analysisAdd BLAST20
Topological domaini195 – 216ExtracellularSequence analysisAdd BLAST22
Transmembranei217 – 240Helical; Name=3Sequence analysisAdd BLAST24
Topological domaini241 – 254CytoplasmicSequence analysisAdd BLAST14
Transmembranei255 – 276Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini277 – 292ExtracellularSequence analysisAdd BLAST16
Transmembranei293 – 316Helical; Name=5Sequence analysisAdd BLAST24
Topological domaini317 – 341CytoplasmicSequence analysisAdd BLAST25
Transmembranei342 – 361Helical; Name=6Sequence analysisAdd BLAST20
Topological domaini362 – 373ExtracellularSequence analysisAdd BLAST12
Transmembranei374 – 393Helical; Name=7Sequence analysisAdd BLAST20
Topological domaini394 – 457CytoplasmicSequence analysisAdd BLAST64

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7433

Open Targets

More...
OpenTargetsi
ENSG00000114812

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37313

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5144

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
371

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
VIPR1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
418253

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30Sequence analysisAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001285531 – 457Vasoactive intestinal polypeptide receptor 1Add BLAST427

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi50 ↔ 72By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi63 ↔ 105By similarity
Glycosylationi69N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi86 ↔ 122By similarity
Glycosylationi100N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi215 ↔ 2851 Publication
Glycosylationi290N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P32241

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P32241

PeptideAtlas

More...
PeptideAtlasi
P32241

PRoteomics IDEntifications database

More...
PRIDEi
P32241

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54848
54849 [P32241-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P32241

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P32241

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P32241

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In lung, HT-29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and SUP-T1, but not in the T-cell lines Peer, MOLT-4, HSB and YT.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000114812 Expressed in 154 organ(s), highest expression level in right lung

CleanEx database of gene expression profiles

More...
CleanExi
HS_VIPR1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P32241 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P32241 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026777

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
VIPP012822EBI-3917984,EBI-6656819

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113274, 35 interactors

Protein interaction database and analysis system

More...
IntActi
P32241, 4 interactors

Molecular INTeraction database

More...
MINTi
P32241

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000327246

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OF2X-ray2.20C400-408[»]
1OGTX-ray1.47C400-408[»]
3B3IX-ray1.86C400-408[»]
3B6SX-ray1.80C400-408[»]
3DTXX-ray2.10C400-408[»]
3HCVX-ray1.95C400-408[»]
5DEFX-ray1.60C400-408[»]
5DEGX-ray1.83C400-408[»]
5IB1X-ray1.91C400-408[»]
5IB2X-ray1.44C400-408[»]
5IB3X-ray1.91C400-408[»]
5IB4X-ray1.95C400-408[»]
5IB5X-ray2.49C/F400-408[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P32241

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P32241

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P32241

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4564 Eukaryota
ENOG410XRS2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156402

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008249

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG008318

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P32241

KEGG Orthology (KO)

More...
KOi
K04589

Identification of Orthologs from Complete Genome Data

More...
OMAi
VWTIIRI

Database of Orthologous Groups

More...
OrthoDBi
651627at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P32241

TreeFam database of animal gene trees

More...
TreeFami
TF315710

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
4.10.1240.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR001571 GPCR_2_VIP_rcpt
IPR001771 GPCR_2_VIP_rcpt_1

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00002 7tm_2, 1 hit
PF02793 HRM, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00249 GPCRSECRETIN
PR00491 VASOACTVEIPR
PR01154 VIP1RECEPTOR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00008 HormR, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111418 SSF111418, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00649 G_PROTEIN_RECEP_F2_1, 1 hit
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Short (identifier: P32241-1) [UniParc]FASTAAdd to basket
Also known as: hIVR8

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPPSPLPAR WLCVLAGALA WALGPAGGQA ARLQEECDYV QMIEVQHKQC
60 70 80 90 100
LEEAQLENET IGCSKMWDNL TCWPATPRGQ VVVLACPLIF KLFSSIQGRN
110 120 130 140 150
VSRSCTDEGW THLEPGPYPI ACGLDDKAAS LDEQQTMFYG SVKTGYTIGY
160 170 180 190 200
GLSLATLLVA TAILSLFRKL HCTRNYIHMH LFISFILRAA AVFIKDLALF
210 220 230 240 250
DSGESDQCSE GSVGCKAAMV FFQYCVMANF FWLLVEGLYL YTLLAVSFFS
260 270 280 290 300
ERKYFWGYIL IGWGVPSTFT MVWTIARIHF EDYGCWDTIN SSLWWIIKGP
310 320 330 340 350
ILTSILVNFI LFICIIRILL QKLRPPDIRK SDSSPYSRLA RSTLLLIPLF
360 370 380 390 400
GVHYIMFAFF PDNFKPEVKM VFELVVGSFQ GFVVAILYCF LNGEVQAELR
410 420 430 440 450
RKWRRWHLQG VLGWNPKYRH PSGGSNGATC STQVSMLTRV SPGARRSSSF

QAEVSLV
Length:457
Mass (Da):51,547
Last modified:October 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDAA40CF5BEC47D7D
GO
Isoform Long (identifier: P32241-2) [UniParc]FASTAAdd to basket
Also known as: hIVR5

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MRPPSPLPARWLCVLAGALAWALGPAGGQAAR → MPPPPLLSLR...RAARSLLGSS

Show »
Length:492
Mass (Da):55,009
Checksum:iD6E529795785C3AA
GO
Isoform 3 (identifier: P32241-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-263: MRPPSPLPAR...YFWGYILIGW → MTRQRVWMRW...PSSLSGSTSG

Show »
Length:247
Mass (Da):28,164
Checksum:i271C125CB317C516
GO
Isoform 4 (identifier: P32241-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETI → MRAGRRPRLGPWAG
     134-134: Missing.

Show »
Length:409
Mass (Da):46,268
Checksum:iC66EA5C02820AB12
GO
Isoform 5 (identifier: P32241-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: Missing.

Show »
Length:416
Mass (Da):47,201
Checksum:i4236FD602880CB8C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JDT8C9JDT8_HUMAN
Vasoactive intestinal polypeptide r...
VIPR1
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JH33C9JH33_HUMAN
Vasoactive intestinal polypeptide r...
VIPR1
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2U6F2Z2U6_HUMAN
Vasoactive intestinal polypeptide r...
VIPR1
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti80Q → R in BAG57795 (PubMed:14702039).Curated1
Sequence conflicti284G → GLLR in CAA54814 (PubMed:8179610).Curated1
Sequence conflicti284G → GLLR in CAA53046 (PubMed:8179610).Curated1
Sequence conflicti320L → F in BAG51813 (PubMed:14702039).Curated1
Sequence conflicti369K → R in BAG57795 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055041341R → M1 PublicationCorresponds to variant dbSNP:rs17855906Ensembl.1
Natural variantiVAR_020021445R → L. Corresponds to variant dbSNP:rs3733055Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451431 – 263MRPPS…ILIGW → MTRQRVWMRWAVRQPWSFSN IVSWLTSSGCWWRASTCTPC LPSPSSLSGSTSG in isoform 3. 1 PublicationAdd BLAST263
Alternative sequenceiVSP_0472711 – 61MRPPS…ENETI → MRAGRRPRLGPWAG in isoform 4. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0472721 – 41Missing in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_0020101 – 32MRPPS…GQAAR → MPPPPLLSLRRLGGGWSAVT RLVVAAAGARSRGGRGGSRG AGGGGRGGVARRRRLELRAA RSLLGSS in isoform Long. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_047273134Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L13288 mRNA Translation: AAA36805.1
U11087
, U11079, U11080, U11081, U11083, U11084, U11085, U11086 Genomic DNA Translation: AAB60362.1
X75299 mRNA Translation: CAA53046.1
X77777 mRNA Translation: CAA54814.1
AB065669 Genomic DNA Translation: BAC05895.1
EF577396 mRNA Translation: ABQ52416.1
AK314334 mRNA Translation: BAG36980.1
AK293548 mRNA Translation: BAG57026.1
AK294609 mRNA Translation: BAG57795.1
AK056819 mRNA Translation: BAG51813.1
AC092047 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64649.1
CH471055 Genomic DNA Translation: EAW64650.1
BC064424 mRNA Translation: AAH64424.1
L20295 mRNA Translation: AAA36802.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2698.1 [P32241-1]
CCDS58827.1 [P32241-4]
CCDS58828.1 [P32241-5]
CCDS58829.1 [P32241-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC2194
JC2195

NCBI Reference Sequences

More...
RefSeqi
NP_001238811.1, NM_001251882.1 [P32241-5]
NP_001238812.1, NM_001251883.1 [P32241-3]
NP_001238813.1, NM_001251884.1 [P32241-4]
NP_001238814.1, NM_001251885.1
NP_004615.2, NM_004624.3 [P32241-1]
XP_005265495.1, XM_005265438.3 [P32241-5]
XP_011532381.1, XM_011534079.1 [P32241-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.348500

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325123; ENSP00000327246; ENSG00000114812 [P32241-1]
ENST00000433647; ENSP00000394950; ENSG00000114812 [P32241-5]
ENST00000438259; ENSP00000415371; ENSG00000114812 [P32241-3]
ENST00000543411; ENSP00000445701; ENSG00000114812 [P32241-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7433

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7433

UCSC genome browser

More...
UCSCi
uc003clf.3 human [P32241-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L13288 mRNA Translation: AAA36805.1
U11087
, U11079, U11080, U11081, U11083, U11084, U11085, U11086 Genomic DNA Translation: AAB60362.1
X75299 mRNA Translation: CAA53046.1
X77777 mRNA Translation: CAA54814.1
AB065669 Genomic DNA Translation: BAC05895.1
EF577396 mRNA Translation: ABQ52416.1
AK314334 mRNA Translation: BAG36980.1
AK293548 mRNA Translation: BAG57026.1
AK294609 mRNA Translation: BAG57795.1
AK056819 mRNA Translation: BAG51813.1
AC092047 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64649.1
CH471055 Genomic DNA Translation: EAW64650.1
BC064424 mRNA Translation: AAH64424.1
L20295 mRNA Translation: AAA36802.1
CCDSiCCDS2698.1 [P32241-1]
CCDS58827.1 [P32241-4]
CCDS58828.1 [P32241-5]
CCDS58829.1 [P32241-3]
PIRiJC2194
JC2195
RefSeqiNP_001238811.1, NM_001251882.1 [P32241-5]
NP_001238812.1, NM_001251883.1 [P32241-3]
NP_001238813.1, NM_001251884.1 [P32241-4]
NP_001238814.1, NM_001251885.1
NP_004615.2, NM_004624.3 [P32241-1]
XP_005265495.1, XM_005265438.3 [P32241-5]
XP_011532381.1, XM_011534079.1 [P32241-5]
UniGeneiHs.348500

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OF2X-ray2.20C400-408[»]
1OGTX-ray1.47C400-408[»]
3B3IX-ray1.86C400-408[»]
3B6SX-ray1.80C400-408[»]
3DTXX-ray2.10C400-408[»]
3HCVX-ray1.95C400-408[»]
5DEFX-ray1.60C400-408[»]
5DEGX-ray1.83C400-408[»]
5IB1X-ray1.91C400-408[»]
5IB2X-ray1.44C400-408[»]
5IB3X-ray1.91C400-408[»]
5IB4X-ray1.95C400-408[»]
5IB5X-ray2.49C/F400-408[»]
ProteinModelPortaliP32241
SMRiP32241
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113274, 35 interactors
IntActiP32241, 4 interactors
MINTiP32241
STRINGi9606.ENSP00000327246

Chemistry databases

ChEMBLiCHEMBL5144
GuidetoPHARMACOLOGYi371

Protein family/group databases

TCDBi9.A.14.4.9 the g-protein-coupled receptor (gpcr) family

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiP32241
PhosphoSitePlusiP32241
SwissPalmiP32241

Polymorphism and mutation databases

BioMutaiVIPR1
DMDMi418253

Proteomic databases

jPOSTiP32241
PaxDbiP32241
PeptideAtlasiP32241
PRIDEiP32241
ProteomicsDBi54848
54849 [P32241-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7433
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325123; ENSP00000327246; ENSG00000114812 [P32241-1]
ENST00000433647; ENSP00000394950; ENSG00000114812 [P32241-5]
ENST00000438259; ENSP00000415371; ENSG00000114812 [P32241-3]
ENST00000543411; ENSP00000445701; ENSG00000114812 [P32241-4]
GeneIDi7433
KEGGihsa:7433
UCSCiuc003clf.3 human [P32241-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7433
DisGeNETi7433
EuPathDBiHostDB:ENSG00000114812.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VIPR1
HGNCiHGNC:12694 VIPR1
HPAiHPA026777
MIMi192321 gene
neXtProtiNX_P32241
OpenTargetsiENSG00000114812
PharmGKBiPA37313

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4564 Eukaryota
ENOG410XRS2 LUCA
GeneTreeiENSGT00940000156402
HOGENOMiHOG000008249
HOVERGENiHBG008318
InParanoidiP32241
KOiK04589
OMAiVWTIIRI
OrthoDBi651627at2759
PhylomeDBiP32241
TreeFamiTF315710

Enzyme and pathway databases

ReactomeiR-HSA-418555 G alpha (s) signalling events
R-HSA-420092 Glucagon-type ligand receptors
SIGNORiP32241

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
VIPR1 human
EvolutionaryTraceiP32241

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
VIPR1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7433

Protein Ontology

More...
PROi
PR:P32241

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000114812 Expressed in 154 organ(s), highest expression level in right lung
CleanExiHS_VIPR1
ExpressionAtlasiP32241 baseline and differential
GenevisibleiP32241 HS

Family and domain databases

Gene3Di4.10.1240.10, 1 hit
InterProiView protein in InterPro
IPR017981 GPCR_2-like
IPR036445 GPCR_2_extracell_dom_sf
IPR001879 GPCR_2_extracellular_dom
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR001571 GPCR_2_VIP_rcpt
IPR001771 GPCR_2_VIP_rcpt_1
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF02793 HRM, 1 hit
PRINTSiPR00249 GPCRSECRETIN
PR00491 VASOACTVEIPR
PR01154 VIP1RECEPTOR
SMARTiView protein in SMART
SM00008 HormR, 1 hit
SUPFAMiSSF111418 SSF111418, 1 hit
PROSITEiView protein in PROSITE
PS00649 G_PROTEIN_RECEP_F2_1, 1 hit
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50227 G_PROTEIN_RECEP_F2_3, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVIPR1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P32241
Secondary accession number(s): A5JUT9
, B3KPV1, B4DEB5, B4DGI4, F5H1F5, G3V0I1, Q15871, Q6P2M6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: January 16, 2019
This is version 179 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  7. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again