Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 192 (13 Feb 2019)
Sequence version 1 (01 Oct 1993)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Gastrin/cholecystokinin type B receptor

Gene

CCKBR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • 1-phosphatidylinositol-3-kinase regulator activity Source: ProtInc
  • cholecystokinin receptor activity Source: GO_Central
  • gastrin receptor activity Source: UniProtKB
  • peptide hormone binding Source: GO_Central
  • type B gastrin/cholecystokinin receptor binding Source: NTNU_SB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-881907 Gastrin-CREB signalling pathway via PKC and MAPK

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P32239

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P32239

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Gastrin/cholecystokinin type B receptor1 Publication
Short name:
CCK-B receptor1 Publication
Short name:
CCK-BR
Alternative name(s):
Cholecystokinin-2 receptor1 Publication
Short name:
CCK2-R
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCKBRImported
Synonyms:CCKRB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000110148.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1571 CCKBR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
118445 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P32239

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 57ExtracellularSequence analysisAdd BLAST57
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei58 – 79Helical; Name=1Sequence analysisAdd BLAST22
Topological domaini80 – 87CytoplasmicSequence analysis8
Transmembranei88 – 109Helical; Name=2Sequence analysisAdd BLAST22
Topological domaini110 – 131ExtracellularSequence analysisAdd BLAST22
Transmembranei132 – 150Helical; Name=3Sequence analysisAdd BLAST19
Topological domaini151 – 170CytoplasmicSequence analysisAdd BLAST20
Transmembranei171 – 189Helical; Name=4Sequence analysisAdd BLAST19
Topological domaini190 – 219ExtracellularSequence analysisAdd BLAST30
Transmembranei220 – 242Helical; Name=5Sequence analysisAdd BLAST23
Topological domaini243 – 333CytoplasmicSequence analysisAdd BLAST91
Transmembranei334 – 355Helical; Name=6Sequence analysisAdd BLAST22
Topological domaini356 – 373ExtracellularSequence analysisAdd BLAST18
Transmembranei374 – 394Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini395 – 447CytoplasmicSequence analysisAdd BLAST53

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
887

Open Targets

More...
OpenTargetsi
ENSG00000110148

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26143

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL298

Drug and drug target database

More...
DrugBanki
DB00183 Pentagastrin

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
77

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CCKBR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
417029

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000694741 – 447Gastrin/cholecystokinin type B receptorAdd BLAST447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi7N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi30N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi127 ↔ 205PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi408S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P32239

PeptideAtlas

More...
PeptideAtlasi
P32239

PRoteomics IDEntifications database

More...
PRIDEi
P32239

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54845
54846 [P32239-2]
54847 [P32239-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P32239

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P32239

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.6 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000110148 Expressed in 105 organ(s), highest expression level in body of stomach

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P32239 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P32239 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107329, 13 interactors

Database of interacting proteins

More...
DIPi
DIP-229N

Protein interaction database and analysis system

More...
IntActi
P32239, 14 interactors

Molecular INTeraction database

More...
MINTi
P32239

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000335544

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P32239

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1447
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L4TNMR-A352-379[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P32239

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P32239

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P32239

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3656 Eukaryota
ENOG410XRW9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154041

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG036927

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P32239

KEGG Orthology (KO)

More...
KOi
K04195

Identification of Orthologs from Complete Genome Data

More...
OMAi
DTCARCC

Database of Orthologous Groups

More...
OrthoDBi
1042780at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P32239

TreeFam database of animal gene trees

More...
TreeFami
TF315303

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009126 Cholcskin_rcpt
IPR000314 Gastrin_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01822 CCYSTOKININR
PR00527 GASTRINR
PR00237 GPCRRHODOPSN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P32239-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELLKLNRSV QGTGPGPGAS LCRPGAPLLN SSSVGNLSCE PPRIRGAGTR
60 70 80 90 100
ELELAIRITL YAVIFLMSVG GNMLIIVVLG LSRRLRTVTN AFLLSLAVSD
110 120 130 140 150
LLLAVACMPF TLLPNLMGTF IFGTVICKAV SYLMGVSVSV STLSLVAIAL
160 170 180 190 200
ERYSAICRPL QARVWQTRSH AARVIVATWL LSGLLMVPYP VYTVVQPVGP
210 220 230 240 250
RVLQCVHRWP SARVRQTWSV LLLLLLFFIP GVVMAVAYGL ISRELYLGLR
260 270 280 290 300
FDGDSDSDSQ SRVRNQGGLP GAVHQNGRCR PETGAVGEDS DGCYVQLPRS
310 320 330 340 350
RPALELTALT APGPGSGSRP TQAKLLAKKR VVRMLLVIVV LFFLCWLPVY
360 370 380 390 400
SANTWRAFDG PGAHRALSGA PISFIHLLSY ASACVNPLVY CFMHRRFRQA
410 420 430 440
CLETCARCCP RPPRARPRAL PDEDPPTPSI ASLSRLSYTT ISTLGPG
Length:447
Mass (Da):48,419
Last modified:October 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBAEEFAD4C1F85915
GO
Isoform 2 (identifier: P32239-2) [UniParc]FASTAAdd to basket
Also known as: CCK-C, CCK-BRi4sv

The sequence of this isoform differs from the canonical sequence as follows:
     271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG

Show »
Length:516
Mass (Da):55,869
Checksum:i9B27DDCAE3A67CC7
GO
Isoform 3 (identifier: P32239-3) [UniParc]FASTAAdd to basket
Also known as: DeltaCCK-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Show »
Length:381
Mass (Da):41,504
Checksum:i2DF92F7D8A27773B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PIC8E9PIC8_HUMAN
Gastrin/cholecystokinin type B rece...
CCKBR
363Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPL7E9PPL7_HUMAN
Gastrin/cholecystokinin type B rece...
CCKBR
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJ49E9PJ49_HUMAN
Gastrin/cholecystokinin type B rece...
CCKBR
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64I → T in AAF67174 (PubMed:10913157).Curated1
Sequence conflicti93L → F in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti96L → M in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti116L → I in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti171A → P in AAA91831 (Ref. 11) Curated1
Sequence conflicti227F → S in BAF84753 (PubMed:14702039).Curated1
Sequence conflicti249L → V in AAA91831 (Ref. 11) Curated1
Sequence conflicti288E → K in AAB30766 (PubMed:8185170).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01468437L → F. Corresponds to variant dbSNP:rs1805000Ensembl.1
Natural variantiVAR_04938877V → G. Corresponds to variant dbSNP:rs35816985Ensembl.1
Natural variantiVAR_014685125V → I. Corresponds to variant dbSNP:rs1805002Ensembl.1
Natural variantiVAR_014686215R → H. Corresponds to variant dbSNP:rs1805004Ensembl.1
Natural variantiVAR_014687319R → Q. Corresponds to variant dbSNP:rs1805001Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0334441 – 66Missing in isoform 3. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_033445271G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L04473 mRNA Translation: AAA35660.1
L08112 mRNA Translation: AAA35657.1
D13305 mRNA Translation: BAA02564.1
L10822 Genomic DNA Translation: AAC37528.1
S70057 mRNA Translation: AAB30766.2
D21219 Genomic DNA Translation: BAA04759.2
AF239668 mRNA Translation: AAF67174.1
AY029770 mRNA Translation: AAK38351.1
AF441129 mRNA Translation: AAN32829.1
L07746 mRNA Translation: AAA91831.1
AK292064 mRNA Translation: BAF84753.1
AY322551 mRNA Translation: AAP84364.1
BT006789 mRNA Translation: AAP35435.1
BC000740 mRNA Translation: AAH00740.1
AH006311 Genomic DNA Translation: AAC27510.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7761.1 [P32239-1]
CCDS86175.1 [P32239-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A47430
I65231

NCBI Reference Sequences

More...
RefSeqi
NP_001304958.1, NM_001318029.1
NP_795344.1, NM_176875.3 [P32239-1]
XP_005253267.1, XM_005253210.1
XP_016874005.1, XM_017018516.1 [P32239-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.203

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000334619; ENSP00000335544; ENSG00000110148 [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148 [P32239-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
887

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:887

UCSC genome browser

More...
UCSCi
uc001mcp.4 human [P32239-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Cholecystokinin receptor entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04473 mRNA Translation: AAA35660.1
L08112 mRNA Translation: AAA35657.1
D13305 mRNA Translation: BAA02564.1
L10822 Genomic DNA Translation: AAC37528.1
S70057 mRNA Translation: AAB30766.2
D21219 Genomic DNA Translation: BAA04759.2
AF239668 mRNA Translation: AAF67174.1
AY029770 mRNA Translation: AAK38351.1
AF441129 mRNA Translation: AAN32829.1
L07746 mRNA Translation: AAA91831.1
AK292064 mRNA Translation: BAF84753.1
AY322551 mRNA Translation: AAP84364.1
BT006789 mRNA Translation: AAP35435.1
BC000740 mRNA Translation: AAH00740.1
AH006311 Genomic DNA Translation: AAC27510.1
CCDSiCCDS7761.1 [P32239-1]
CCDS86175.1 [P32239-2]
PIRiA47430
I65231
RefSeqiNP_001304958.1, NM_001318029.1
NP_795344.1, NM_176875.3 [P32239-1]
XP_005253267.1, XM_005253210.1
XP_016874005.1, XM_017018516.1 [P32239-3]
UniGeneiHs.203

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L4TNMR-A352-379[»]
ProteinModelPortaliP32239
SMRiP32239
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107329, 13 interactors
DIPiDIP-229N
IntActiP32239, 14 interactors
MINTiP32239
STRINGi9606.ENSP00000335544

Chemistry databases

BindingDBiP32239
ChEMBLiCHEMBL298
DrugBankiDB00183 Pentagastrin
GuidetoPHARMACOLOGYi77

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiP32239
PhosphoSitePlusiP32239

Polymorphism and mutation databases

BioMutaiCCKBR
DMDMi417029

Proteomic databases

PaxDbiP32239
PeptideAtlasiP32239
PRIDEiP32239
ProteomicsDBi54845
54846 [P32239-2]
54847 [P32239-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
887
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334619; ENSP00000335544; ENSG00000110148 [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148 [P32239-2]
GeneIDi887
KEGGihsa:887
UCSCiuc001mcp.4 human [P32239-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
887
DisGeNETi887
EuPathDBiHostDB:ENSG00000110148.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CCKBR
HGNCiHGNC:1571 CCKBR
MIMi118445 gene
neXtProtiNX_P32239
OpenTargetsiENSG00000110148
PharmGKBiPA26143

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00940000154041
HOVERGENiHBG036927
InParanoidiP32239
KOiK04195
OMAiDTCARCC
OrthoDBi1042780at2759
PhylomeDBiP32239
TreeFamiTF315303

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-881907 Gastrin-CREB signalling pathway via PKC and MAPK
SignaLinkiP32239
SIGNORiP32239

Miscellaneous databases

EvolutionaryTraceiP32239

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Cholecystokinin_B_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
887

Protein Ontology

More...
PROi
PR:P32239

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000110148 Expressed in 105 organ(s), highest expression level in body of stomach
ExpressionAtlasiP32239 baseline and differential
GenevisibleiP32239 HS

Family and domain databases

InterProiView protein in InterPro
IPR009126 Cholcskin_rcpt
IPR000314 Gastrin_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01822 CCYSTOKININR
PR00527 GASTRINR
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGASR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P32239
Secondary accession number(s): A8K7P9
, O75824, Q16144, Q92492, Q96LC6, Q9NYK7, Q9UBV1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: February 13, 2019
This is version 192 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  7. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again