Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gastrin/cholecystokinin type B receptor

Gene

CCKBR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.

GO - Molecular functioni

  • 1-phosphatidylinositol-3-kinase regulator activity Source: ProtInc
  • cholecystokinin receptor activity Source: GO_Central
  • gastrin receptor activity Source: UniProtKB
  • peptide hormone binding Source: GO_Central
  • type B gastrin/cholecystokinin receptor binding Source: NTNU_SB

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-881907 Gastrin-CREB signalling pathway via PKC and MAPK
SignaLinkiP32239
SIGNORiP32239

Names & Taxonomyi

Protein namesi
Recommended name:
Gastrin/cholecystokinin type B receptor1 Publication
Short name:
CCK-B receptor1 Publication
Short name:
CCK-BR
Alternative name(s):
Cholecystokinin-2 receptor1 Publication
Short name:
CCK2-R
Gene namesi
Name:CCKBRImported
Synonyms:CCKRB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000110148.9
HGNCiHGNC:1571 CCKBR
MIMi118445 gene
neXtProtiNX_P32239

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 57ExtracellularSequence analysisAdd BLAST57
Transmembranei58 – 79Helical; Name=1Sequence analysisAdd BLAST22
Topological domaini80 – 87CytoplasmicSequence analysis8
Transmembranei88 – 109Helical; Name=2Sequence analysisAdd BLAST22
Topological domaini110 – 131ExtracellularSequence analysisAdd BLAST22
Transmembranei132 – 150Helical; Name=3Sequence analysisAdd BLAST19
Topological domaini151 – 170CytoplasmicSequence analysisAdd BLAST20
Transmembranei171 – 189Helical; Name=4Sequence analysisAdd BLAST19
Topological domaini190 – 219ExtracellularSequence analysisAdd BLAST30
Transmembranei220 – 242Helical; Name=5Sequence analysisAdd BLAST23
Topological domaini243 – 333CytoplasmicSequence analysisAdd BLAST91
Transmembranei334 – 355Helical; Name=6Sequence analysisAdd BLAST22
Topological domaini356 – 373ExtracellularSequence analysisAdd BLAST18
Transmembranei374 – 394Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini395 – 447CytoplasmicSequence analysisAdd BLAST53

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi887
OpenTargetsiENSG00000110148
PharmGKBiPA26143

Chemistry databases

ChEMBLiCHEMBL298
DrugBankiDB00183 Pentagastrin
GuidetoPHARMACOLOGYi77

Polymorphism and mutation databases

BioMutaiCCKBR
DMDMi417029

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000694741 – 447Gastrin/cholecystokinin type B receptorAdd BLAST447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi7N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi30N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi127 ↔ 205PROSITE-ProRule annotation
Lipidationi408S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiP32239
PeptideAtlasiP32239
PRIDEiP32239
ProteomicsDBi54845
54846 [P32239-2]
54847 [P32239-3]

PTM databases

iPTMnetiP32239
PhosphoSitePlusiP32239

Expressioni

Tissue specificityi

Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the small cell lung cancer cell line NCI-H510, at lower levels in NCI-H345, NCI-H69 and GLC-28 cell lines, not expressed in GLC-19 cell line. Within the stomach, expressed at high levels in the mucosa of the gastric fundus and at low levels in the antrum and duodenum. Isoform 2 is present in pancreatic cancer cells and colorectal cancer cells, but not in normal pancreas or colonic mucosa. Isoform 3 is expressed in brain, pancreas, stomach, the stomach cancer cell line AGS and the colon cancer cell line LoVo.6 Publications

Gene expression databases

BgeeiENSG00000110148 Expressed in 105 organ(s), highest expression level in body of stomach
CleanExiHS_CCKBR
ExpressionAtlasiP32239 baseline and differential
GenevisibleiP32239 HS

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107329, 13 interactors
DIPiDIP-229N
IntActiP32239, 11 interactors
MINTiP32239
STRINGi9606.ENSP00000335544

Chemistry databases

BindingDBiP32239

Structurei

Secondary structure

1447
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP32239
SMRiP32239
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP32239

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00920000148959
HOVERGENiHBG036927
InParanoidiP32239
KOiK04195
OMAiWRAFDGP
OrthoDBiEOG091G084J
PhylomeDBiP32239
TreeFamiTF315303

Family and domain databases

InterProiView protein in InterPro
IPR009126 Cholcskin_rcpt
IPR000314 Gastrin_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01822 CCYSTOKININR
PR00527 GASTRINR
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P32239-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELLKLNRSV QGTGPGPGAS LCRPGAPLLN SSSVGNLSCE PPRIRGAGTR
60 70 80 90 100
ELELAIRITL YAVIFLMSVG GNMLIIVVLG LSRRLRTVTN AFLLSLAVSD
110 120 130 140 150
LLLAVACMPF TLLPNLMGTF IFGTVICKAV SYLMGVSVSV STLSLVAIAL
160 170 180 190 200
ERYSAICRPL QARVWQTRSH AARVIVATWL LSGLLMVPYP VYTVVQPVGP
210 220 230 240 250
RVLQCVHRWP SARVRQTWSV LLLLLLFFIP GVVMAVAYGL ISRELYLGLR
260 270 280 290 300
FDGDSDSDSQ SRVRNQGGLP GAVHQNGRCR PETGAVGEDS DGCYVQLPRS
310 320 330 340 350
RPALELTALT APGPGSGSRP TQAKLLAKKR VVRMLLVIVV LFFLCWLPVY
360 370 380 390 400
SANTWRAFDG PGAHRALSGA PISFIHLLSY ASACVNPLVY CFMHRRFRQA
410 420 430 440
CLETCARCCP RPPRARPRAL PDEDPPTPSI ASLSRLSYTT ISTLGPG
Length:447
Mass (Da):48,419
Last modified:October 1, 1993 - v1
Checksum:iBAEEFAD4C1F85915
GO
Isoform 2 (identifier: P32239-2) [UniParc]FASTAAdd to basket
Also known as: CCK-C, CCK-BRi4sv

The sequence of this isoform differs from the canonical sequence as follows:
     271-271: G → GGAGPREQNLGEAELWRATGPAGVGGTEMKVRVRRKLEMELSWERRSGGDWAGDWGDSPFSLTAHPLCSG

Show »
Length:516
Mass (Da):55,869
Checksum:i9B27DDCAE3A67CC7
GO
Isoform 3 (identifier: P32239-3) [UniParc]FASTAAdd to basket
Also known as: DeltaCCK-B

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Show »
Length:381
Mass (Da):41,504
Checksum:i2DF92F7D8A27773B
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PIC8E9PIC8_HUMAN
Gastrin/cholecystokinin type B rece...
CCKBR
363Annotation score:
E9PPL7E9PPL7_HUMAN
Gastrin/cholecystokinin type B rece...
CCKBR
136Annotation score:
E9PJ49E9PJ49_HUMAN
Gastrin/cholecystokinin type B rece...
CCKBR
87Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64I → T in AAF67174 (PubMed:10913157).Curated1
Sequence conflicti93L → F in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti96L → M in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti116L → I in AAC27510 (PubMed:9872672).Curated1
Sequence conflicti171A → P in AAA91831 (Ref. 11) Curated1
Sequence conflicti227F → S in BAF84753 (PubMed:14702039).Curated1
Sequence conflicti249L → V in AAA91831 (Ref. 11) Curated1
Sequence conflicti288E → K in AAB30766 (PubMed:8185170).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01468437L → F. Corresponds to variant dbSNP:rs1805000Ensembl.1
Natural variantiVAR_04938877V → G. Corresponds to variant dbSNP:rs35816985Ensembl.1
Natural variantiVAR_014685125V → I. Corresponds to variant dbSNP:rs1805002Ensembl.1
Natural variantiVAR_014686215R → H. Corresponds to variant dbSNP:rs1805004Ensembl.1
Natural variantiVAR_014687319R → Q. Corresponds to variant dbSNP:rs1805001Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0334441 – 66Missing in isoform 3. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_033445271G → GGAGPREQNLGEAELWRATG PAGVGGTEMKVRVRRKLEME LSWERRSGGDWAGDWGDSPF SLTAHPLCSG in isoform 2. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04473 mRNA Translation: AAA35660.1
L08112 mRNA Translation: AAA35657.1
D13305 mRNA Translation: BAA02564.1
L10822 Genomic DNA Translation: AAC37528.1
S70057 mRNA Translation: AAB30766.2
D21219 Genomic DNA Translation: BAA04759.2
AF239668 mRNA Translation: AAF67174.1
AY029770 mRNA Translation: AAK38351.1
AF441129 mRNA Translation: AAN32829.1
L07746 mRNA Translation: AAA91831.1
AK292064 mRNA Translation: BAF84753.1
AY322551 mRNA Translation: AAP84364.1
BT006789 mRNA Translation: AAP35435.1
BC000740 mRNA Translation: AAH00740.1
AH006311 Genomic DNA Translation: AAC27510.1
CCDSiCCDS7761.1 [P32239-1]
CCDS86175.1 [P32239-2]
PIRiA47430
I65231
RefSeqiNP_001304958.1, NM_001318029.1
NP_795344.1, NM_176875.3 [P32239-1]
XP_005253267.1, XM_005253210.1 [P32239-2]
XP_016874005.1, XM_017018516.1 [P32239-3]
UniGeneiHs.203

Genome annotation databases

EnsembliENST00000334619; ENSP00000335544; ENSG00000110148 [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148 [P32239-2]
GeneIDi887
KEGGihsa:887
UCSCiuc001mcp.4 human [P32239-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Cholecystokinin receptor entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L04473 mRNA Translation: AAA35660.1
L08112 mRNA Translation: AAA35657.1
D13305 mRNA Translation: BAA02564.1
L10822 Genomic DNA Translation: AAC37528.1
S70057 mRNA Translation: AAB30766.2
D21219 Genomic DNA Translation: BAA04759.2
AF239668 mRNA Translation: AAF67174.1
AY029770 mRNA Translation: AAK38351.1
AF441129 mRNA Translation: AAN32829.1
L07746 mRNA Translation: AAA91831.1
AK292064 mRNA Translation: BAF84753.1
AY322551 mRNA Translation: AAP84364.1
BT006789 mRNA Translation: AAP35435.1
BC000740 mRNA Translation: AAH00740.1
AH006311 Genomic DNA Translation: AAC27510.1
CCDSiCCDS7761.1 [P32239-1]
CCDS86175.1 [P32239-2]
PIRiA47430
I65231
RefSeqiNP_001304958.1, NM_001318029.1
NP_795344.1, NM_176875.3 [P32239-1]
XP_005253267.1, XM_005253210.1 [P32239-2]
XP_016874005.1, XM_017018516.1 [P32239-3]
UniGeneiHs.203

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1L4TNMR-A352-379[»]
ProteinModelPortaliP32239
SMRiP32239
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107329, 13 interactors
DIPiDIP-229N
IntActiP32239, 11 interactors
MINTiP32239
STRINGi9606.ENSP00000335544

Chemistry databases

BindingDBiP32239
ChEMBLiCHEMBL298
DrugBankiDB00183 Pentagastrin
GuidetoPHARMACOLOGYi77

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiP32239
PhosphoSitePlusiP32239

Polymorphism and mutation databases

BioMutaiCCKBR
DMDMi417029

Proteomic databases

PaxDbiP32239
PeptideAtlasiP32239
PRIDEiP32239
ProteomicsDBi54845
54846 [P32239-2]
54847 [P32239-3]

Protocols and materials databases

DNASUi887
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334619; ENSP00000335544; ENSG00000110148 [P32239-1]
ENST00000525462; ENSP00000435534; ENSG00000110148 [P32239-2]
GeneIDi887
KEGGihsa:887
UCSCiuc001mcp.4 human [P32239-1]

Organism-specific databases

CTDi887
DisGeNETi887
EuPathDBiHostDB:ENSG00000110148.9
GeneCardsiCCKBR
HGNCiHGNC:1571 CCKBR
MIMi118445 gene
neXtProtiNX_P32239
OpenTargetsiENSG00000110148
PharmGKBiPA26143
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00920000148959
HOVERGENiHBG036927
InParanoidiP32239
KOiK04195
OMAiWRAFDGP
OrthoDBiEOG091G084J
PhylomeDBiP32239
TreeFamiTF315303

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-881907 Gastrin-CREB signalling pathway via PKC and MAPK
SignaLinkiP32239
SIGNORiP32239

Miscellaneous databases

EvolutionaryTraceiP32239
GeneWikiiCholecystokinin_B_receptor
GenomeRNAii887
PROiPR:P32239
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000110148 Expressed in 105 organ(s), highest expression level in body of stomach
CleanExiHS_CCKBR
ExpressionAtlasiP32239 baseline and differential
GenevisibleiP32239 HS

Family and domain databases

InterProiView protein in InterPro
IPR009126 Cholcskin_rcpt
IPR000314 Gastrin_rcpt
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR01822 CCYSTOKININR
PR00527 GASTRINR
PR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGASR_HUMAN
AccessioniPrimary (citable) accession number: P32239
Secondary accession number(s): A8K7P9
, O75824, Q16144, Q92492, Q96LC6, Q9NYK7, Q9UBV1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1993
Last sequence update: October 1, 1993
Last modified: October 10, 2018
This is version 188 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  7. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again