Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Stress-induced-phosphoprotein 1

Gene

STIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a co-chaperone for HSP90AA1 (PubMed:27353360). Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90 (By similarity).1 PublicationBy similarity

GO - Molecular functioni

Enzyme and pathway databases

ReactomeiR-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)

Names & Taxonomyi

Protein namesi
Recommended name:
Stress-induced-phosphoprotein 1
Short name:
STI1
Alternative name(s):
Hsc70/Hsp90-organizing protein
Short name:
Hop
Renal carcinoma antigen NY-REN-11
Transformation-sensitive protein IEF SSP 3521
Gene namesi
Name:STIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000168439.16
HGNCiHGNC:11387 STIP1
MIMi605063 gene
neXtProtiNX_P31948

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi10963
OpenTargetsiENSG00000168439
PharmGKBiPA36196

Polymorphism and mutation databases

BioMutaiSTIP1
DMDMi400042

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001063721 – 543Stress-induced-phosphoprotein 1Add BLAST543

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei8N6-acetyllysineCombined sources1
Modified residuei16PhosphoserineCombined sources1
Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei198PhosphothreonineCombined sources1
Cross-linki210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei301N6-acetyllysineCombined sources1
Modified residuei312N6-acetyllysineCombined sources1
Modified residuei325N6-acetyllysineCombined sources1
Modified residuei332PhosphothreonineCombined sources1
Modified residuei344N6-acetyllysineCombined sources1
Modified residuei354PhosphotyrosineCombined sources1
Modified residuei446N6-acetyllysineCombined sources1
Modified residuei481PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP31948
PaxDbiP31948
PeptideAtlasiP31948
PRIDEiP31948
ProteomicsDBi54820
TopDownProteomicsiP31948-1 [P31948-1]

2D gel databases

REPRODUCTION-2DPAGEiIPI00013894
UCD-2DPAGEiP31948

PTM databases

iPTMnetiP31948
PhosphoSitePlusiP31948
SwissPalmiP31948

Expressioni

Gene expression databases

BgeeiENSG00000168439 Expressed in 231 organ(s), highest expression level in testis
CleanExiHS_STIP1
ExpressionAtlasiP31948 baseline and differential
GenevisibleiP31948 HS

Organism-specific databases

HPAiCAB017448
HPA039291
HPA044062

Interactioni

Subunit structurei

Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2 (PubMed:29127155). Forms a complex with HSPA8/HSC70, HSPCA/HSP-86 and HSPCB/HSP-84 (By similarity). Interacts with PACRG (PubMed:14532270). Interacts with METTL21B (PubMed:23349634). Interacts with HSP90/HSP90AA1; the interaction dissociates the PPP5C:HSP90AA1 interaction (PubMed:9195923, PubMed:27353360). Interacts with FLCN, FNIP1 and FNIP2 (PubMed:27353360). Interacts with HSPA8/HSC70 (By similarity). Interacts with HSP90AB1; upon SMYD2-dependent HSP90AB1 methylation (PubMed:24880080).By similarity6 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116162, 190 interactors
DIPiDIP-41085N
IntActiP31948, 109 interactors
MINTiP31948
STRINGi9606.ENSP00000305958

Structurei

Secondary structure

1543
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP31948
SMRiP31948
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP31948

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati4 – 37TPR 1Add BLAST34
Repeati38 – 71TPR 2Add BLAST34
Repeati72 – 105TPR 3Add BLAST34
Domaini130 – 169STI1 1Add BLAST40
Repeati225 – 258TPR 4Add BLAST34
Repeati259 – 292TPR 5Add BLAST34
Repeati300 – 333TPR 6Add BLAST34
Repeati360 – 393TPR 7Add BLAST34
Repeati394 – 427TPR 8Add BLAST34
Repeati428 – 461TPR 9Add BLAST34
Domaini492 – 531STI1 2Add BLAST40

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi222 – 239Bipartite nuclear localization signalSequence analysisAdd BLAST18

Domaini

The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

eggNOGiKOG0548 Eukaryota
ENOG410XTCJ LUCA
GeneTreeiENSGT00900000140989
HOGENOMiHOG000186562
HOVERGENiHBG057820
InParanoidiP31948
KOiK09553
OMAiKDPAMRM
OrthoDBiEOG091G0E5W
PhylomeDBiP31948
TreeFamiTF300478

Family and domain databases

Gene3Di1.25.40.10, 3 hits
InterProiView protein in InterPro
IPR006636 STI1_HS-bd
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR013105 TPR_2
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF07719 TPR_2, 1 hit
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00727 STI1, 2 hits
SM00028 TPR, 9 hits
SUPFAMiSSF48452 SSF48452, 3 hits
PROSITEiView protein in PROSITE
PS50005 TPR, 9 hits
PS50293 TPR_REGION, 2 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P31948-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQVNELKEK GNKALSVGNI DDALQCYSEA IKLDPHNHVL YSNRSAAYAK
60 70 80 90 100
KGDYQKAYED GCKTVDLKPD WGKGYSRKAA ALEFLNRFEE AKRTYEEGLK
110 120 130 140 150
HEANNPQLKE GLQNMEARLA ERKFMNPFNM PNLYQKLESD PRTRTLLSDP
160 170 180 190 200
TYRELIEQLR NKPSDLGTKL QDPRIMTTLS VLLGVDLGSM DEEEEIATPP
210 220 230 240 250
PPPPPKKETK PEPMEEDLPE NKKQALKEKE LGNDAYKKKD FDTALKHYDK
260 270 280 290 300
AKELDPTNMT YITNQAAVYF EKGDYNKCRE LCEKAIEVGR ENREDYRQIA
310 320 330 340 350
KAYARIGNSY FKEEKYKDAI HFYNKSLAEH RTPDVLKKCQ QAEKILKEQE
360 370 380 390 400
RLAYINPDLA LEEKNKGNEC FQKGDYPQAM KHYTEAIKRN PKDAKLYSNR
410 420 430 440 450
AACYTKLLEF QLALKDCEEC IQLEPTFIKG YTRKAAALEA MKDYTKAMDV
460 470 480 490 500
YQKALDLDSS CKEAADGYQR CMMAQYNRHD SPEDVKRRAM ADPEVQQIMS
510 520 530 540
DPAMRLILEQ MQKDPQALSE HLKNPVIAQK IQKLMDVGLI AIR
Length:543
Mass (Da):62,639
Last modified:July 1, 1993 - v1
Checksum:i8E58ECA13825CB0E
GO
Isoform 2 (identifier: P31948-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MEQ → MESGSPMGEVEISRTIRTNGRGQRGYDWQCKRPIRVAEVRSSLHSWSLRW

Show »
Length:590
Mass (Da):68,080
Checksum:i76F4C7A16BFCBCA0
GO
Isoform 3 (identifier: P31948-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-97: Missing.

Show »
Length:519
Mass (Da):59,778
Checksum:i0D7C993B4B4E230E
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H783F5H783_HUMAN
Stress-induced-phosphoprotein 1
STIP1
236Annotation score:
H0YGI8H0YGI8_HUMAN
Stress-induced-phosphoprotein 1
STIP1
137Annotation score:
F5GXD8F5GXD8_HUMAN
Stress-induced-phosphoprotein 1
STIP1
138Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti84F → L in AAH39299 (PubMed:15489334).Curated1
Sequence conflicti364K → E in BAG59782 (PubMed:14702039).Curated1
Sequence conflicti533K → R in BAG59782 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0550341 – 3MEQ → MESGSPMGEVEISRTIRTNG RGQRGYDWQCKRPIRVAEVR SSLHSWSLRW in isoform 2. 1 Publication3
Alternative sequenceiVSP_05503574 – 97Missing in isoform 3. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86752 mRNA Translation: AAA58682.1
BT020010 mRNA Translation: AAV38813.1
BT020011 mRNA Translation: AAV38814.1
CR536512 mRNA Translation: CAG38750.1
AK297319 mRNA Translation: BAG59782.1
AP005668 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74196.1
CH471076 Genomic DNA Translation: EAW74197.1
BC002987 mRNA Translation: AAH02987.1
BC039299 mRNA Translation: AAH39299.1
CCDSiCCDS60827.1 [P31948-2]
CCDS60828.1 [P31948-3]
CCDS8058.1 [P31948-1]
PIRiA38093
RefSeqiNP_001269581.1, NM_001282652.1 [P31948-2]
NP_001269582.1, NM_001282653.1 [P31948-3]
NP_006810.1, NM_006819.2 [P31948-1]
UniGeneiHs.337295

Genome annotation databases

EnsembliENST00000305218; ENSP00000305958; ENSG00000168439 [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439 [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439 [P31948-3]
GeneIDi10963
KEGGihsa:10963
UCSCiuc010rnb.2 human [P31948-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86752 mRNA Translation: AAA58682.1
BT020010 mRNA Translation: AAV38813.1
BT020011 mRNA Translation: AAV38814.1
CR536512 mRNA Translation: CAG38750.1
AK297319 mRNA Translation: BAG59782.1
AP005668 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74196.1
CH471076 Genomic DNA Translation: EAW74197.1
BC002987 mRNA Translation: AAH02987.1
BC039299 mRNA Translation: AAH39299.1
CCDSiCCDS60827.1 [P31948-2]
CCDS60828.1 [P31948-3]
CCDS8058.1 [P31948-1]
PIRiA38093
RefSeqiNP_001269581.1, NM_001282652.1 [P31948-2]
NP_001269582.1, NM_001282653.1 [P31948-3]
NP_006810.1, NM_006819.2 [P31948-1]
UniGeneiHs.337295

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ELRX-ray1.90A223-352[»]
1ELWX-ray1.60A/B1-118[»]
2LNINMR-A356-477[»]
2NC9NMR-A220-350[»]
3ESKX-ray2.05A223-350[»]
3FWVX-ray2.20A/B223-349[»]
ProteinModelPortaliP31948
SMRiP31948
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116162, 190 interactors
DIPiDIP-41085N
IntActiP31948, 109 interactors
MINTiP31948
STRINGi9606.ENSP00000305958

PTM databases

iPTMnetiP31948
PhosphoSitePlusiP31948
SwissPalmiP31948

Polymorphism and mutation databases

BioMutaiSTIP1
DMDMi400042

2D gel databases

REPRODUCTION-2DPAGEiIPI00013894
UCD-2DPAGEiP31948

Proteomic databases

EPDiP31948
PaxDbiP31948
PeptideAtlasiP31948
PRIDEiP31948
ProteomicsDBi54820
TopDownProteomicsiP31948-1 [P31948-1]

Protocols and materials databases

DNASUi10963
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305218; ENSP00000305958; ENSG00000168439 [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439 [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439 [P31948-3]
GeneIDi10963
KEGGihsa:10963
UCSCiuc010rnb.2 human [P31948-1]

Organism-specific databases

CTDi10963
DisGeNETi10963
EuPathDBiHostDB:ENSG00000168439.16
GeneCardsiSTIP1
HGNCiHGNC:11387 STIP1
HPAiCAB017448
HPA039291
HPA044062
MIMi605063 gene
neXtProtiNX_P31948
OpenTargetsiENSG00000168439
PharmGKBiPA36196
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0548 Eukaryota
ENOG410XTCJ LUCA
GeneTreeiENSGT00900000140989
HOGENOMiHOG000186562
HOVERGENiHBG057820
InParanoidiP31948
KOiK09553
OMAiKDPAMRM
OrthoDBiEOG091G0E5W
PhylomeDBiP31948
TreeFamiTF300478

Enzyme and pathway databases

ReactomeiR-HSA-3371497 HSP90 chaperone cycle for steroid hormone receptors (SHR)

Miscellaneous databases

ChiTaRSiSTIP1 human
EvolutionaryTraceiP31948
GeneWikiiHop_(protein)
GenomeRNAii10963
PROiPR:P31948
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168439 Expressed in 231 organ(s), highest expression level in testis
CleanExiHS_STIP1
ExpressionAtlasiP31948 baseline and differential
GenevisibleiP31948 HS

Family and domain databases

Gene3Di1.25.40.10, 3 hits
InterProiView protein in InterPro
IPR006636 STI1_HS-bd
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR013105 TPR_2
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF07719 TPR_2, 1 hit
PF13181 TPR_8, 1 hit
SMARTiView protein in SMART
SM00727 STI1, 2 hits
SM00028 TPR, 9 hits
SUPFAMiSSF48452 SSF48452, 3 hits
PROSITEiView protein in PROSITE
PS50005 TPR, 9 hits
PS50293 TPR_REGION, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiSTIP1_HUMAN
AccessioniPrimary (citable) accession number: P31948
Secondary accession number(s): B4DM70
, F5H0T1, G3XAD8, Q3ZCU9, Q5TZU9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: September 12, 2018
This is version 199 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again