Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P31948 (STIP1_HUMAN)

Entry version 217 (07 Apr 2021)
Sequence version 1 (01 Jul 1993)
Previous versions | rss
Add a publicationFeedback
Protein

Stress-induced-phosphoprotein 1

Gene

STIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a co-chaperone for HSP90AA1 (PubMed:27353360). Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90 (By similarity).1 PublicationBy similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P31948

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-3371497, HSP90 chaperone cycle for steroid hormone receptors (SHR)

SIGNOR Signaling Network Open Resource

More...SIGNORi		P31948

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Stress-induced-phosphoprotein 1
Short name:
STI1
Alternative name(s):
Hsc70/Hsp90-organizing protein
Short name:
Hop
Renal carcinoma antigen NY-REN-11
Transformation-sensitive protein IEF SSP 3521
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STIP1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11387, STIP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605063, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P31948

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000168439.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		10963

Open Targets

More...OpenTargetsi		ENSG00000168439

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36196

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P31948, Tbio

Chemistry databases

Drug and drug target database

More...DrugBanki		DB09130, Copper

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		STIP1

Domain mapping of disease mutations (DMDM)

More...DMDMi		400042

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001063721 – 543Stress-induced-phosphoprotein 1Add BLAST543

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei8N6-acetyllysineCombined sources1
Modified residuei16PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki123Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei198PhosphothreonineCombined sources1
Cross-linki210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei301N6-acetyllysineCombined sources1
Modified residuei312N6-acetyllysineCombined sources1
Modified residuei325N6-acetyllysineCombined sources1
Modified residuei332PhosphothreonineCombined sources1
Modified residuei344N6-acetyllysineCombined sources1
Modified residuei354PhosphotyrosineCombined sources1
Modified residuei446N6-acetyllysineCombined sources1
Modified residuei481PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P31948

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P31948

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P31948

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P31948

PeptideAtlas

More...PeptideAtlasi		P31948

PRoteomics IDEntifications database

More...PRIDEi		P31948

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		25436
33721
54820 [P31948-1]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P31948-1 [P31948-1]

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00013894

University College Dublin 2-DE Proteome Database

More...UCD-2DPAGEi		P31948

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P31948

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P31948

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P31948

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P31948

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000168439, Expressed in testis and 243 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P31948, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P31948, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000168439, Tissue enhanced (vagina)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2 (PubMed:29127155).

Forms a complex with HSPA8/HSC70, HSPCA/HSP-86 and HSPCB/HSP-84 (By similarity).

Interacts with PACRG (PubMed:14532270).

Interacts with METTL21B (PubMed:23349634).

Interacts with HSP90/HSP90AA1; the interaction dissociates the PPP5C:HSP90AA1 interaction (PubMed:9195923, PubMed:27353360).

Interacts with FLCN, FNIP1 and FNIP2 (PubMed:27353360).

Interacts with HSPA8/HSC70 (By similarity).

Interacts with HSP90AB1; upon SMYD2-dependent HSP90AB1 methylation (PubMed:24880080).

By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116162, 276 interactors

Database of interacting proteins

More...DIPi		DIP-41085N

Protein interaction database and analysis system

More...IntActi		P31948, 152 interactors

Molecular INTeraction database

More...MINTi		P31948

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000351646

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P31948, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1543
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P31948

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P31948

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati4 – 37TPR 1Add BLAST34
Repeati38 – 71TPR 2Add BLAST34
Repeati72 – 105TPR 3Add BLAST34
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini130 – 169STI1 1Add BLAST40
Repeati225 – 258TPR 4Add BLAST34
Repeati259 – 292TPR 5Add BLAST34
Repeati300 – 333TPR 6Add BLAST34
Repeati360 – 393TPR 7Add BLAST34
Repeati394 – 427TPR 8Add BLAST34
Repeati428 – 461TPR 9Add BLAST34
Domaini492 – 531STI1 2Add BLAST40

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi222 – 239Bipartite nuclear localization signalSequence analysisAdd BLAST18

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The TPR 1 repeat interacts with the C-terminal of HSC70. The TPR 4, 5 and 6 repeats (also called TPR2A domain) and TPR 7, 8 and 9 repeats (also called TPR2B domain) interact with HSP90.

Keywords - Domaini

Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0548, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154911

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000134_46_5_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P31948

Identification of Orthologs from Complete Genome Data

More...OMAi		KDPAMRM

Database of Orthologous Groups

More...OrthoDBi		933764at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P31948

TreeFam database of animal gene trees

More...TreeFami		TF300478

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.10, 3 hits

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00449

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR041243, STI1
IPR006636, STI1_HS-bd
IPR013026, TPR-contain_dom
IPR011990, TPR-like_helical_dom_sf
IPR013105, TPR_2
IPR019734, TPR_repeat

Pfam protein domain database

More...Pfami		View protein in Pfam
PF17830, STI1, 2 hits
PF07719, TPR_2, 1 hit
PF13181, TPR_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00727, STI1, 2 hits
SM00028, TPR, 9 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48452, SSF48452, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50005, TPR, 9 hits
PS50293, TPR_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P31948-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQVNELKEK GNKALSVGNI DDALQCYSEA IKLDPHNHVL YSNRSAAYAK 
        60         70         80         90        100
KGDYQKAYED GCKTVDLKPD WGKGYSRKAA ALEFLNRFEE AKRTYEEGLK 
       110        120        130        140        150
HEANNPQLKE GLQNMEARLA ERKFMNPFNM PNLYQKLESD PRTRTLLSDP 
       160        170        180        190        200
TYRELIEQLR NKPSDLGTKL QDPRIMTTLS VLLGVDLGSM DEEEEIATPP 
       210        220        230        240        250
PPPPPKKETK PEPMEEDLPE NKKQALKEKE LGNDAYKKKD FDTALKHYDK 
       260        270        280        290        300
AKELDPTNMT YITNQAAVYF EKGDYNKCRE LCEKAIEVGR ENREDYRQIA 
       310        320        330        340        350
KAYARIGNSY FKEEKYKDAI HFYNKSLAEH RTPDVLKKCQ QAEKILKEQE 
       360        370        380        390        400
RLAYINPDLA LEEKNKGNEC FQKGDYPQAM KHYTEAIKRN PKDAKLYSNR 
       410        420        430        440        450
AACYTKLLEF QLALKDCEEC IQLEPTFIKG YTRKAAALEA MKDYTKAMDV 
       460        470        480        490        500
YQKALDLDSS CKEAADGYQR CMMAQYNRHD SPEDVKRRAM ADPEVQQIMS 
       510        520        530        540 
DPAMRLILEQ MQKDPQALSE HLKNPVIAQK IQKLMDVGLI AIR
Length:543
Mass (Da):62,639
Last modified:July 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8E58ECA13825CB0E
GO
Isoform 2 (identifier: P31948-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MEQ → MESGSPMGEVEISRTIRTNGRGQRGYDWQCKRPIRVAEVRSSLHSWSLRW

Show »
Length:590
Mass (Da):68,080
Checksum:i76F4C7A16BFCBCA0
GO
Isoform 3 (identifier: P31948-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-97: Missing.

Show »
Length:519
Mass (Da):59,778
Checksum:i0D7C993B4B4E230E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H783F5H783_HUMAN
Stress-induced-phosphoprotein 1
STIP1
236Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGI8H0YGI8_HUMAN
Stress-induced-phosphoprotein 1
STIP1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXD8F5GXD8_HUMAN
Stress-induced-phosphoprotein 1
STIP1
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti84F → L in AAH39299 (PubMed:15489334).Curated1
Sequence conflicti364K → E in BAG59782 (PubMed:14702039).Curated1
Sequence conflicti533K → R in BAG59782 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0550341 – 3MEQ → MESGSPMGEVEISRTIRTNG RGQRGYDWQCKRPIRVAEVR SSLHSWSLRW in isoform 2. 1 Publication3
Alternative sequenceiVSP_05503574 – 97Missing in isoform 3. 1 PublicationAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M86752 mRNA Translation: AAA58682.1
BT020010 mRNA Translation: AAV38813.1
BT020011 mRNA Translation: AAV38814.1
CR536512 mRNA Translation: CAG38750.1
AK297319 mRNA Translation: BAG59782.1
AP005668 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74196.1
CH471076 Genomic DNA Translation: EAW74197.1
BC002987 mRNA Translation: AAH02987.1
BC039299 mRNA Translation: AAH39299.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS60827.1 [P31948-2]
CCDS60828.1 [P31948-3]
CCDS8058.1 [P31948-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A38093

NCBI Reference Sequences

More...RefSeqi		NP_001269581.1, NM_001282652.1 [P31948-2]
NP_001269582.1, NM_001282653.1 [P31948-3]
NP_006810.1, NM_006819.2 [P31948-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000305218; ENSP00000305958; ENSG00000168439 [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439 [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439 [P31948-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10963

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10963

UCSC genome browser

More...UCSCi		uc010rnb.2, human [P31948-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M86752 mRNA Translation: AAA58682.1
BT020010 mRNA Translation: AAV38813.1
BT020011 mRNA Translation: AAV38814.1
CR536512 mRNA Translation: CAG38750.1
AK297319 mRNA Translation: BAG59782.1
AP005668 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74196.1
CH471076 Genomic DNA Translation: EAW74197.1
BC002987 mRNA Translation: AAH02987.1
BC039299 mRNA Translation: AAH39299.1
CCDSiCCDS60827.1 [P31948-2]
CCDS60828.1 [P31948-3]
CCDS8058.1 [P31948-1]
PIRiA38093
RefSeqiNP_001269581.1, NM_001282652.1 [P31948-2]
NP_001269582.1, NM_001282653.1 [P31948-3]
NP_006810.1, NM_006819.2 [P31948-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ELRX-ray1.90A223-352[»]
1ELWX-ray1.60A/B1-118[»]
2LNINMR-A356-477[»]
2NC9NMR-A220-350[»]
3ESKX-ray2.05A223-350[»]
3FWVX-ray2.20A/B223-349[»]
SMRiP31948
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116162, 276 interactors
DIPiDIP-41085N
IntActiP31948, 152 interactors
MINTiP31948
STRINGi9606.ENSP00000351646

Chemistry databases

DrugBankiDB09130, Copper

PTM databases

iPTMnetiP31948
MetOSiteiP31948
PhosphoSitePlusiP31948
SwissPalmiP31948

Genetic variation databases

BioMutaiSTIP1
DMDMi400042

2D gel databases

REPRODUCTION-2DPAGEiIPI00013894
UCD-2DPAGEiP31948

Proteomic databases

EPDiP31948
jPOSTiP31948
MassIVEiP31948
PaxDbiP31948
PeptideAtlasiP31948
PRIDEiP31948
ProteomicsDBi25436
33721
54820 [P31948-1]
TopDownProteomicsiP31948-1 [P31948-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		15273, 424 antibodies

The DNASU plasmid repository

More...DNASUi		10963

Genome annotation databases

EnsembliENST00000305218; ENSP00000305958; ENSG00000168439 [P31948-1]
ENST00000358794; ENSP00000351646; ENSG00000168439 [P31948-2]
ENST00000538945; ENSP00000445957; ENSG00000168439 [P31948-3]
GeneIDi10963
KEGGihsa:10963
UCSCiuc010rnb.2, human [P31948-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10963
DisGeNETi10963

GeneCards: human genes, protein and diseases

More...GeneCardsi		STIP1
HGNCiHGNC:11387, STIP1
HPAiENSG00000168439, Tissue enhanced (vagina)
MIMi605063, gene
neXtProtiNX_P31948
OpenTargetsiENSG00000168439
PharmGKBiPA36196
VEuPathDBiHostDB:ENSG00000168439.16

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0548, Eukaryota
GeneTreeiENSGT00940000154911
HOGENOMiCLU_000134_46_5_1
InParanoidiP31948
OMAiKDPAMRM
OrthoDBi933764at2759
PhylomeDBiP31948
TreeFamiTF300478

Enzyme and pathway databases

PathwayCommonsiP31948
ReactomeiR-HSA-3371497, HSP90 chaperone cycle for steroid hormone receptors (SHR)
SIGNORiP31948

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		10963, 83 hits in 1002 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		STIP1, human
EvolutionaryTraceiP31948

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Hop_(protein)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10963
PharosiP31948, Tbio

Protein Ontology

More...PROi		PR:P31948
RNActiP31948, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000168439, Expressed in testis and 243 other tissues
ExpressionAtlasiP31948, baseline and differential
GenevisibleiP31948, HS

Family and domain databases

Gene3Di1.25.40.10, 3 hits
IDEALiIID00449
InterProiView protein in InterPro
IPR041243, STI1
IPR006636, STI1_HS-bd
IPR013026, TPR-contain_dom
IPR011990, TPR-like_helical_dom_sf
IPR013105, TPR_2
IPR019734, TPR_repeat
PfamiView protein in Pfam
PF17830, STI1, 2 hits
PF07719, TPR_2, 1 hit
PF13181, TPR_8, 1 hit
SMARTiView protein in SMART
SM00727, STI1, 2 hits
SM00028, TPR, 9 hits
SUPFAMiSSF48452, SSF48452, 3 hits
PROSITEiView protein in PROSITE
PS50005, TPR, 9 hits
PS50293, TPR_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTIP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P31948
Secondary accession number(s): B4DM70
, F5H0T1, G3XAD8, Q3ZCU9, Q5TZU9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: April 7, 2021
This is version 217 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again