Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Syndecan-4

Gene

SDC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • fibronectin binding Source: Ensembl
  • identical protein binding Source: IntAct
  • protein kinase C binding Source: Ensembl
  • thrombospondin receptor activity Source: BHF-UCL

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1971475 A tetrasaccharide linker sequence is required for GAG synthesis
R-HSA-2022928 HS-GAG biosynthesis
R-HSA-2024096 HS-GAG degradation
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-3000170 Syndecan interactions
R-HSA-3560783 Defective B4GALT7 causes EDS, progeroid type
R-HSA-3560801 Defective B3GAT3 causes JDSSDHD
R-HSA-3656237 Defective EXT2 causes exostoses 2
R-HSA-3656253 Defective EXT1 causes exostoses 1, TRPS2 and CHDS
R-HSA-4420332 Defective B3GALT6 causes EDSP2 and SEMDJL1
R-HSA-975634 Retinoid metabolism and transport

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P31431

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.A.35.1.1 the peptide translocating syndecan (syndecan) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Syndecan-4
Short name:
SYND4
Alternative name(s):
Amphiglycan
Ryudocan core protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SDC4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000124145.6

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10661 SDC4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600017 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P31431

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini19 – 145ExtracellularSequence analysisAdd BLAST127
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei146 – 170HelicalSequence analysisAdd BLAST25
Topological domaini171 – 198CytoplasmicSequence analysisAdd BLAST28

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
6385

Open Targets

More...
OpenTargetsi
ENSG00000124145

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35591

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SDC4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2851418

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Sequence analysisAdd BLAST18
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003351119 – 198Syndecan-4Add BLAST180

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi39O-linked (Xyl...) (heparan sulfate) serineBy similarity1
Glycosylationi61O-linked (Xyl...) (heparan sulfate) serineSequence analysis1
Glycosylationi63O-linked (Xyl...) (heparan sulfate) serineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Shedding is enhanced by a number of factors such as heparanase, thrombin or EGF. Also by stress and wound healing. PMA-mediated shedding is inhibited by TIMP3.1 Publication

Keywords - PTMi

Glycoprotein, Heparan sulfate, Proteoglycan

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P31431

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P31431

PeptideAtlas

More...
PeptideAtlasi
P31431

PRoteomics IDEntifications database

More...
PRIDEi
P31431

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54789

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P31431-1 [P31431-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P31431

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P31431

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P31431

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in epithelial and fibroblastic cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124145 Expressed in 227 organ(s), highest expression level in nasal cavity epithelium

CleanEx database of gene expression profiles

More...
CleanExi
HS_SDC4

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P31431 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB013240
HPA005716

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts (via its cytoplasmic domain) with GIPC (via its PDZ domain). Interacts (via its cytoplasmic domain) with NUDT16L1 (By similarity). Interacts with CDCP1 and SDCBP.By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112286, 20 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P31431

Database of interacting proteins

More...
DIPi
DIP-29945N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P31431

Protein interaction database and analysis system

More...
IntActi
P31431, 19 interactors

Molecular INTeraction database

More...
MINTi
P31431

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361818

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P31431

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P31431

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P31431

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the syndecan proteoglycan family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IXIG Eukaryota
ENOG4111QSA LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160663

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000263414

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004501

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P31431

KEGG Orthology (KO)

More...
KOi
K16338

Identification of Orthologs from Complete Genome Data

More...
OMAi
QEPDDFE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0OOE

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P31431

TreeFam database of animal gene trees

More...
TreeFami
TF320463

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003585 Neurexin-like
IPR001050 Syndecan
IPR027789 Syndecan/Neurexin_dom
IPR030479 Syndecan_CS

The PANTHER Classification System

More...
PANTHERi
PTHR10915 PTHR10915, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01034 Syndecan, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00294 4.1m, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00964 SYNDECAN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P31431-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPARLFALL LFFVGGVAES IRETEVIDPQ DLLEGRYFSG ALPDDEDVVG
60 70 80 90 100
PGQESDDFEL SGSGDLDDLE DSMIGPEVVH PLVPLDNHIP ERAGSGSQVP
110 120 130 140 150
TEPKKLEENE VIPKRISPVE ESEDVSNKVS MSSTVQGSNI FERTEVLAAL
160 170 180 190
IVGGIVGILF AVFLILLLMY RMKKKDEGSY DLGKKPIYKK APTNEFYA
Length:198
Mass (Da):21,642
Last modified:July 15, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8229AA2733F77A10
GO
Isoform 2 (identifier: P31431-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-198: ALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA → GCPEH

Note: Soluble form, lacks the transmembrane domain.
Show »
Length:153
Mass (Da):16,545
Checksum:i25AD50751A7D2642
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02185112F → L2 PublicationsCorresponds to variant dbSNP:rs2228384Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044449149 – 198ALIVG…NEFYA → GCPEH in isoform 2. 2 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X67016 mRNA Translation: CAA47406.1
D13292 mRNA Translation: BAA02550.1
D79206 Genomic DNA Translation: BAA19613.1
AK312507 mRNA Translation: BAG35408.1
CR542045 mRNA Translation: CAG46842.1
CR542074 mRNA Translation: CAG46871.1
AK222695 mRNA Translation: BAD96415.1
AK223243 mRNA Translation: BAD96963.1
AL021578 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75861.1
CH471077 Genomic DNA Translation: EAW75862.1
BC030805 mRNA Translation: AAH30805.1
AA151028 mRNA No translation available.
AA258502 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13350.1 [P31431-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC1457

NCBI Reference Sequences

More...
RefSeqi
NP_002990.2, NM_002999.3 [P31431-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.632267

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372733; ENSP00000361818; ENSG00000124145 [P31431-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6385

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6385

UCSC genome browser

More...
UCSCi
uc002xnu.4 human [P31431-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X67016 mRNA Translation: CAA47406.1
D13292 mRNA Translation: BAA02550.1
D79206 Genomic DNA Translation: BAA19613.1
AK312507 mRNA Translation: BAG35408.1
CR542045 mRNA Translation: CAG46842.1
CR542074 mRNA Translation: CAG46871.1
AK222695 mRNA Translation: BAD96415.1
AK223243 mRNA Translation: BAD96963.1
AL021578 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75861.1
CH471077 Genomic DNA Translation: EAW75862.1
BC030805 mRNA Translation: AAH30805.1
AA151028 mRNA No translation available.
AA258502 mRNA No translation available.
CCDSiCCDS13350.1 [P31431-1]
PIRiJC1457
RefSeqiNP_002990.2, NM_002999.3 [P31431-1]
UniGeneiHs.632267

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1EJPNMR-A/B171-198[»]
1EJQNMR-A/B171-198[»]
1OBYX-ray1.85P/Q193-198[»]
1YBOX-ray2.30C/D182-198[»]
ProteinModelPortaliP31431
SMRiP31431
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112286, 20 interactors
CORUMiP31431
DIPiDIP-29945N
ELMiP31431
IntActiP31431, 19 interactors
MINTiP31431
STRINGi9606.ENSP00000361818

Protein family/group databases

TCDBi9.A.35.1.1 the peptide translocating syndecan (syndecan) family

PTM databases

iPTMnetiP31431
PhosphoSitePlusiP31431

Polymorphism and mutation databases

BioMutaiSDC4
DMDMi2851418

Proteomic databases

EPDiP31431
PaxDbiP31431
PeptideAtlasiP31431
PRIDEiP31431
ProteomicsDBi54789
TopDownProteomicsiP31431-1 [P31431-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6385
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372733; ENSP00000361818; ENSG00000124145 [P31431-1]
GeneIDi6385
KEGGihsa:6385
UCSCiuc002xnu.4 human [P31431-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6385
DisGeNETi6385
EuPathDBiHostDB:ENSG00000124145.6

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SDC4
HGNCiHGNC:10661 SDC4
HPAiCAB013240
HPA005716
MIMi600017 gene
neXtProtiNX_P31431
OpenTargetsiENSG00000124145
PharmGKBiPA35591

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IXIG Eukaryota
ENOG4111QSA LUCA
GeneTreeiENSGT00940000160663
HOGENOMiHOG000263414
HOVERGENiHBG004501
InParanoidiP31431
KOiK16338
OMAiQEPDDFE
OrthoDBiEOG091G0OOE
PhylomeDBiP31431
TreeFamiTF320463

Enzyme and pathway databases

ReactomeiR-HSA-1971475 A tetrasaccharide linker sequence is required for GAG synthesis
R-HSA-2022928 HS-GAG biosynthesis
R-HSA-2024096 HS-GAG degradation
R-HSA-202733 Cell surface interactions at the vascular wall
R-HSA-3000170 Syndecan interactions
R-HSA-3560783 Defective B4GALT7 causes EDS, progeroid type
R-HSA-3560801 Defective B3GAT3 causes JDSSDHD
R-HSA-3656237 Defective EXT2 causes exostoses 2
R-HSA-3656253 Defective EXT1 causes exostoses 1, TRPS2 and CHDS
R-HSA-4420332 Defective B3GALT6 causes EDSP2 and SEMDJL1
R-HSA-975634 Retinoid metabolism and transport
SIGNORiP31431

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SDC4 human
EvolutionaryTraceiP31431

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SDC4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6385
PMAP-CutDBiP31431

Protein Ontology

More...
PROi
PR:P31431

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000124145 Expressed in 227 organ(s), highest expression level in nasal cavity epithelium
CleanExiHS_SDC4
GenevisibleiP31431 HS

Family and domain databases

InterProiView protein in InterPro
IPR003585 Neurexin-like
IPR001050 Syndecan
IPR027789 Syndecan/Neurexin_dom
IPR030479 Syndecan_CS
PANTHERiPTHR10915 PTHR10915, 1 hit
PfamiView protein in Pfam
PF01034 Syndecan, 1 hit
SMARTiView protein in SMART
SM00294 4.1m, 1 hit
PROSITEiView protein in PROSITE
PS00964 SYNDECAN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSDC4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P31431
Secondary accession number(s): O00773
, Q16833, Q53FN9, Q6FGN3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 15, 1998
Last modified: December 5, 2018
This is version 192 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again