Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ribonucleoside-diphosphate reductase subunit M2

Gene

RRM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling.

Miscellaneous

Two distinct regulatory sites have been defined: the specificity site, which controls substrate specificity, and the activity site which regulates overall catalytic activity. A substrate-binding catalytic site, located on M1, is formed only in the presence of the second subunit M2.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Fe cationBy similarityNote: Binds 2 iron ions per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: DNA replication

This protein is involved in the pathway DNA replication, which is part of Genetic information processing.
View all proteins of this organism that are known to be involved in the pathway DNA replication and in Genetic information processing.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi138Iron 1PROSITE-ProRule annotation1
Metal bindingi169Iron 1PROSITE-ProRule annotation1
Metal bindingi169Iron 2By similarity1
Metal bindingi172Iron 1PROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei176PROSITE-ProRule annotation1
Metal bindingi232Iron 2By similarity1
Metal bindingi266Iron 2By similarity1
Metal bindingi269Iron 2By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processDNA replication
LigandIron, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS10398-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.17.4.1 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-499943 Interconversion of nucleotide di- and triphosphates
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-8953750 Transcriptional Regulation by E2F6

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P31350

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00326

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ribonucleoside-diphosphate reductase subunit M2 (EC:1.17.4.1)
Alternative name(s):
Ribonucleotide reductase small chain
Ribonucleotide reductase small subunit
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RRM2
Synonyms:RR2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000171848.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10452 RRM2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
180390 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P31350

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi20S → A: Enhances inhibitory effect on Wnt signaling. 1
Mutagenesisi20S → E: Prevents inhibitory effect on Wnt signaling. 1

Organism-specific databases

DisGeNET

More...
DisGeNETi
6241

Open Targets

More...
OpenTargetsi
ENSG00000171848

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA299

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1954

Drug and drug target database

More...
DrugBanki
DB00242 Cladribine
DB05260 Gallium nitrate
DB05801 GTI 2040
DB05003 Imexon
DB05428 motexafin gadolinium

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2631

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RRM2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
400979

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001904471 – 389Ribonucleoside-diphosphate reductase subunit M2Add BLAST389

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei20PhosphoserineBy similarity1
Modified residuei33PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation on Ser-20 relieves the inhibitory effect on Wnt signaling.

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P31350

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P31350

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P31350

PeptideAtlas

More...
PeptideAtlasi
P31350

PRoteomics IDEntifications database

More...
PRIDEi
P31350

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54784

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P31350

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P31350

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P31350

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171848 Expressed in 163 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_RRM2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P31350 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P31350 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA056994

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of a large and a small subunit.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112155, 57 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-2194 Ribonucleoside-diphosphate reductase RR1 complex, RRM2 variant

Database of interacting proteins

More...
DIPi
DIP-24232N

Protein interaction database and analysis system

More...
IntActi
P31350, 24 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000353770

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P31350

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1389
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P31350

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P31350

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P31350

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1567 Eukaryota
COG0208 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013305

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000255975

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001647

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P31350

KEGG Orthology (KO)

More...
KOi
K10808

Identification of Orthologs from Complete Genome Data

More...
OMAi
CNRRCQQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0AZQ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P31350

TreeFam database of animal gene trees

More...
TreeFami
TF300465

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01049 RNRR2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.620.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009078 Ferritin-like_SF
IPR012348 RNR-like
IPR033909 RNR_small
IPR030475 RNR_small_AS
IPR000358 RNR_small_fam

The PANTHER Classification System

More...
PANTHERi
PTHR23409 PTHR23409, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00268 Ribonuc_red_sm, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47240 SSF47240, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00368 RIBORED_SMALL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P31350-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSLRVPLAP ITDPQQLQLS PLKGLSLVDK ENTPPALSGT RVLASKTARR
60 70 80 90 100
IFQEPTEPKT KAAAPGVEDE PLLRENPRRF VIFPIEYHDI WQMYKKAEAS
110 120 130 140 150
FWTAEEVDLS KDIQHWESLK PEERYFISHV LAFFAASDGI VNENLVERFS
160 170 180 190 200
QEVQITEARC FYGFQIAMEN IHSEMYSLLI DTYIKDPKER EFLFNAIETM
210 220 230 240 250
PCVKKKADWA LRWIGDKEAT YGERVVAFAA VEGIFFSGSF ASIFWLKKRG
260 270 280 290 300
LMPGLTFSNE LISRDEGLHC DFACLMFKHL VHKPSEERVR EIIINAVRIE
310 320 330 340 350
QEFLTEALPV KLIGMNCTLM KQYIEFVADR LMLELGFSKV FRVENPFDFM
360 370 380
ENISLEGKTN FFEKRVGEYQ RMGVMSSPTE NSFTLDADF
Length:389
Mass (Da):44,878
Last modified:July 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i10E6F5F84D34DA94
GO
Isoform 2 (identifier: P31350-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGRVGGMAQPMGRAGAPKPMGRAGSARRGRFKGCWSEGSPVHPVPAVLSWLLALLRCASTM

Note: No experimental confirmation available.Curated
Show »
Length:449
Mass (Da):51,093
Checksum:iDFEA2E41A26BD80E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JXC1C9JXC1_HUMAN
Ribonucleoside-diphosphate reductas...
RRM2
289Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence DA477511 differs from that shown. Reason: Frameshift at position 87.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P31350-2)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti28R → H in DA477511 (PubMed:14702039).Curated1
Sequence conflicti59S → A in DA477511 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0449171M → MGRVGGMAQPMGRAGAPKPM GRAGSARRGRFKGCWSEGSP VHPVPAVLSWLLALLRCAST M in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X59618 mRNA Translation: CAA42181.1
S40301 mRNA Translation: AAA09577.1
AY032750 Genomic DNA Translation: AAK51163.1
AK313719 mRNA Translation: BAG36462.1
DA477511 mRNA No translation available.
AC104794 Genomic DNA Translation: AAX93099.1
AC118058 Genomic DNA No translation available.
BC001886 mRNA Translation: AAH01886.1
BC030154 mRNA Translation: AAH30154.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1669.1 [P31350-1]
CCDS54334.1 [P31350-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
S25854

NCBI Reference Sequences

More...
RefSeqi
NP_001025.1, NM_001034.3 [P31350-1]
NP_001159403.1, NM_001165931.1 [P31350-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.226390

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304567; ENSP00000302955; ENSG00000171848 [P31350-1]
ENST00000360566; ENSP00000353770; ENSG00000171848 [P31350-2]
ENST00000615152; ENSP00000484183; ENSG00000171848 [P31350-2]
ENST00000641198; ENSP00000493399; ENSG00000171848 [P31350-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6241

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6241

UCSC genome browser

More...
UCSCi
uc021vdr.3 human [P31350-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Ribonucleotide reductase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X59618 mRNA Translation: CAA42181.1
S40301 mRNA Translation: AAA09577.1
AY032750 Genomic DNA Translation: AAK51163.1
AK313719 mRNA Translation: BAG36462.1
DA477511 mRNA No translation available.
AC104794 Genomic DNA Translation: AAX93099.1
AC118058 Genomic DNA No translation available.
BC001886 mRNA Translation: AAH01886.1
BC030154 mRNA Translation: AAH30154.1
CCDSiCCDS1669.1 [P31350-1]
CCDS54334.1 [P31350-2]
PIRiS25854
RefSeqiNP_001025.1, NM_001034.3 [P31350-1]
NP_001159403.1, NM_001165931.1 [P31350-2]
UniGeneiHs.226390

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2UW2X-ray2.80A60-389[»]
3OLJX-ray2.10A/B/C/D66-350[»]
3VPMX-ray2.70A/B66-350[»]
3VPNX-ray2.25A/B66-350[»]
3VPOX-ray2.30A/B66-350[»]
ProteinModelPortaliP31350
SMRiP31350
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112155, 57 interactors
ComplexPortaliCPX-2194 Ribonucleoside-diphosphate reductase RR1 complex, RRM2 variant
DIPiDIP-24232N
IntActiP31350, 24 interactors
STRINGi9606.ENSP00000353770

Chemistry databases

BindingDBiP31350
ChEMBLiCHEMBL1954
DrugBankiDB00242 Cladribine
DB05260 Gallium nitrate
DB05801 GTI 2040
DB05003 Imexon
DB05428 motexafin gadolinium
GuidetoPHARMACOLOGYi2631

PTM databases

iPTMnetiP31350
PhosphoSitePlusiP31350

Polymorphism and mutation databases

BioMutaiRRM2
DMDMi400979

Proteomic databases

EPDiP31350
MaxQBiP31350
PaxDbiP31350
PeptideAtlasiP31350
PRIDEiP31350
ProteomicsDBi54784

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6241
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304567; ENSP00000302955; ENSG00000171848 [P31350-1]
ENST00000360566; ENSP00000353770; ENSG00000171848 [P31350-2]
ENST00000615152; ENSP00000484183; ENSG00000171848 [P31350-2]
ENST00000641198; ENSP00000493399; ENSG00000171848 [P31350-1]
GeneIDi6241
KEGGihsa:6241
UCSCiuc021vdr.3 human [P31350-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6241
DisGeNETi6241
EuPathDBiHostDB:ENSG00000171848.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RRM2
HGNCiHGNC:10452 RRM2
HPAiHPA056994
MIMi180390 gene
neXtProtiNX_P31350
OpenTargetsiENSG00000171848
PharmGKBiPA299

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1567 Eukaryota
COG0208 LUCA
GeneTreeiENSGT00390000013305
HOGENOMiHOG000255975
HOVERGENiHBG001647
InParanoidiP31350
KOiK10808
OMAiCNRRCQQ
OrthoDBiEOG091G0AZQ
PhylomeDBiP31350
TreeFamiTF300465

Enzyme and pathway databases

UniPathwayi
UPA00326

BioCyciMetaCyc:HS10398-MONOMER
BRENDAi1.17.4.1 2681
ReactomeiR-HSA-499943 Interconversion of nucleotide di- and triphosphates
R-HSA-539107 Activation of E2F1 target genes at G1/S
R-HSA-8953750 Transcriptional Regulation by E2F6
SIGNORiP31350

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RRM2 human
EvolutionaryTraceiP31350

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RRM2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6241
PMAP-CutDBiP31350

Protein Ontology

More...
PROi
PR:P31350

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171848 Expressed in 163 organ(s), highest expression level in secondary oocyte
CleanExiHS_RRM2
ExpressionAtlasiP31350 baseline and differential
GenevisibleiP31350 HS

Family and domain databases

CDDicd01049 RNRR2, 1 hit
Gene3Di1.10.620.20, 1 hit
InterProiView protein in InterPro
IPR009078 Ferritin-like_SF
IPR012348 RNR-like
IPR033909 RNR_small
IPR030475 RNR_small_AS
IPR000358 RNR_small_fam
PANTHERiPTHR23409 PTHR23409, 1 hit
PfamiView protein in Pfam
PF00268 Ribonuc_red_sm, 1 hit
SUPFAMiSSF47240 SSF47240, 1 hit
PROSITEiView protein in PROSITE
PS00368 RIBORED_SMALL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRIR2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P31350
Secondary accession number(s): B2R9B5, J3KP43, Q5WRU7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: July 1, 1993
Last modified: December 5, 2018
This is version 195 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again