Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large 1 tumor suppressor protein

Gene

dlg1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

During embryonic development, some isoforms are essential for proper neuronal differentiation and organization. Required for cell polarity; maintenance of apicobasal polarity. Plays a critical role at septate junctions in cellular growth control during larval development. The presence of a guanylate kinase domain suggests involvement in cellular adhesion as well as signal transduction to control cellular proliferation.3 Publications

GO - Molecular functioni

  • epidermal growth factor receptor binding Source: FlyBase
  • guanylate kinase activity Source: FlyBase
  • ionotropic glutamate receptor binding Source: GO_Central

GO - Biological processi

  • anterior/posterior axis specification, follicular epithelium Source: BHF-UCL
  • asymmetric protein localization involved in cell fate determination Source: FlyBase
  • basal protein localization Source: FlyBase
  • behavioral response to ethanol Source: FlyBase
  • cell adhesion Source: UniProtKB-KW
  • cell fate commitment involved in pattern specification Source: BHF-UCL
  • cell fate specification Source: BHF-UCL
  • cell proliferation Source: FlyBase
  • chemical synaptic transmission Source: FlyBase
  • dorsal closure Source: FlyBase
  • establishment of mitotic spindle orientation Source: FlyBase
  • establishment of spindle orientation Source: FlyBase
  • establishment or maintenance of epithelial cell apical/basal polarity Source: FlyBase
  • establishment or maintenance of neuroblast polarity Source: FlyBase
  • establishment or maintenance of polarity of embryonic epithelium Source: FlyBase
  • establishment or maintenance of polarity of follicular epithelium Source: FlyBase
  • establishment or maintenance of polarity of larval imaginal disc epithelium Source: FlyBase
  • gravitaxis Source: FlyBase
  • locomotor rhythm Source: FlyBase
  • male courtship behavior Source: FlyBase
  • mating behavior Source: FlyBase
  • morphogenesis of an epithelium Source: FlyBase
  • morphogenesis of a polarized epithelium Source: FlyBase
  • morphogenesis of follicular epithelium Source: FlyBase
  • morphogenesis of larval imaginal disc epithelium Source: FlyBase
  • negative regulation of cell proliferation Source: FlyBase
  • negative regulation of transcription by RNA polymerase II Source: BHF-UCL
  • nervous system development Source: FlyBase
  • ovarian follicle cell development Source: BHF-UCL
  • pole plasm protein localization Source: BHF-UCL
  • positive phototaxis Source: FlyBase
  • positive regulation of synaptic growth at neuromuscular junction Source: FlyBase
  • protein localization Source: FlyBase
  • receptor clustering Source: GO_Central
  • receptor localization to synapse Source: GO_Central
  • regulation of border follicle cell delamination Source: FlyBase
  • regulation of cell proliferation Source: FlyBase
  • regulation of epidermal growth factor receptor signaling pathway Source: BHF-UCL
  • regulation of JAK-STAT cascade Source: BHF-UCL
  • regulation of Notch signaling pathway Source: BHF-UCL
  • septate junction assembly Source: FlyBase
  • signal transduction Source: UniProtKB-KW
  • synaptic growth at neuromuscular junction Source: FlyBase

Keywordsi

Molecular functionDevelopmental protein, Transducer
Biological processCell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-DME-438066 Unblocking of NMDA receptor, glutamate binding and activation
R-DME-442729 CREB phosphorylation through the activation of CaMKII
R-DME-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-DME-451308 Activation of Ca-permeable Kainate Receptor
R-DME-5625900 RHO GTPases activate CIT
R-DME-5673001 RAF/MAP kinase cascade
R-DME-6794361 Neurexins and neuroligins
R-DME-8849932 Synaptic adhesion-like molecules
SignaLinkiP31007

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large 1 tumor suppressor protein
Gene namesi
Name:dlg1
Synonyms:l(1)dlg1
ORF Names:CG1725
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0001624 dlg1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945381 – 970Disks large 1 tumor suppressor proteinAdd BLAST970

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei496Phosphoserine1 Publication1
Modified residuei714Phosphothreonine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP31007
PRIDEiP31007

PTM databases

iPTMnetiP31007

Expressioni

Tissue specificityi

During the cellular blastoderm stage, isoform B, isoform F, isoform H, isoform I and isoform L expression is localized to the cell borders. From stage 11 onwards, expression is found predominantly in the developing nervous system: axon bundles in the ventral cord and the brain. Stage 14 and 15 embryos exhibit expression in the developing body wall muscle. Expression in neuropil regions of the CNS and at NMJs persists through to larval development. Other isoforms show expression in embryonic epithelial cells. In larvae, expression is seen as a belt around salivary glands, imaginal disks and proventriculus. Expressed in adult reproductive tissues. In epithelia, coexpressed with scrib throughout development.3 Publications

Developmental stagei

Expressed both maternally and zygotically throughout development.1 Publication

Gene expression databases

BgeeiFBgn0001624
ExpressionAtlasiP31007 baseline and differential
GenevisibleiP31007 DM

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

  • epidermal growth factor receptor binding Source: FlyBase
  • ionotropic glutamate receptor binding Source: GO_Central

Protein-protein interaction databases

BioGridi58494, 42 interactors
DIPiDIP-31531N
IntActiP31007, 59 interactors
MINTiP31007
STRINGi7227.FBpp0290503

Structurei

Secondary structure

1970
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi8 – 10Combined sources3
Helixi11 – 21Combined sources11
Helixi25 – 27Combined sources3
Helixi28 – 58Combined sources31
Turni59 – 61Combined sources3
Helixi67 – 83Combined sources17
Helixi84 – 86Combined sources3
Beta strandi87 – 90Combined sources4
Beta strandi624 – 627Combined sources4
Beta strandi651 – 656Combined sources6
Beta strandi659 – 665Combined sources7
Beta strandi679 – 681Combined sources3
Helixi683 – 691Combined sources9
Beta strandi769 – 776Combined sources8
Beta strandi783 – 787Combined sources5
Helixi790 – 800Combined sources11
Turni802 – 804Combined sources3
Turni822 – 824Combined sources3
Helixi832 – 840Combined sources9
Beta strandi844 – 850Combined sources7
Beta strandi853 – 858Combined sources6
Helixi859 – 868Combined sources10
Beta strandi871 – 874Combined sources4
Helixi879 – 886Combined sources8
Beta strandi892 – 896Combined sources5
Helixi901 – 906Combined sources6
Helixi915 – 930Combined sources16
Turni931 – 933Combined sources3
Beta strandi935 – 938Combined sources4
Helixi943 – 957Combined sources15
Beta strandi960 – 965Combined sources6

3D structure databases

ProteinModelPortaliP31007
SMRiP31007
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 64L27PROSITE-ProRule annotationAdd BLAST61
Domaini216 – 303PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini330 – 421PDZ 2PROSITE-ProRule annotationAdd BLAST92
Domaini506 – 587PDZ 3PROSITE-ProRule annotationAdd BLAST82
Domaini620 – 690SH3PROSITE-ProRule annotationAdd BLAST71
Domaini780 – 955Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
InParanoidiP31007
KOiK12076
OMAiNPKCIDH
OrthoDBiEOG091G0BB1
PhylomeDBiP31007

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF00595 PDZ, 3 hits
PF00018 SH3_1, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 2 hits
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: P31007-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVKKQEAHR ALELLEDYHA RLSEPQDRAL RIAIERVIRI FKSRLFQALL
60 70 80 90 100
DIQEFYELTL LDDSKSIQQK TAETLQIATK WEKDGQAVKI ADFIKSSNLN
110 120 130 140 150
RNCAYEFNND ASSNQTNQSA LNQNPIANNV SAQAQAEALS RTFKSELEEI
160 170 180 190 200
LNQRMRIESD TENAKEPTVE QQQKQQQAQQ RSSRSPQQQN PQQQQGSKSR
210 220 230 240 250
SGSQTVNGDD SWLYEDIQLE RGNSGLGFSI AGGTDNPHIG TDTSIYITKL
260 270 280 290 300
ISGGAAAADG RLSINDIIVS VNDVSVVDVP HASAVDALKK AGNVVKLHVK
310 320 330 340 350
RKRGTATTPA AGSAAGDARD SAASGPKVIE IDLVKGGKGL GFSIAGGIGN
360 370 380 390 400
QHIPGDNGIY VTKLMDGGAA QVDGRLSIGD KLIAVRTNGS EKNLENVTHE
410 420 430 440 450
LAVATLKSIT DKVTLIIGKT QHLTTSASGG GGGGLSSGQQ LSQSQSQLAT
460 470 480 490 500
SQSQSQVHQQ QHATPMVNSQ STEPGSRYAS TNVLAAVPPG TPRAVSTEDI
510 520 530 540 550
TREPRTITIQ KGPQGLGFNI VGGEDGQGIY VSFILAGGPA DLGSELKRGD
560 570 580 590 600
QLLSVNNVNL THATHEEAAQ ALKTSGGVVT LLAQYRPEEY NRFEARIQEL
610 620 630 640 650
KQQAALGAGG SGTLLRTTQK RSLYVRALFD YDPNRDDGLP SRGLPFKHGD
660 670 680 690 700
ILHVTNASDD EWWQARRVLG DNEDEQIGIV PSKRRWERKM RARDRSVKFQ
710 720 730 740 750
GHAAANNNLD KQSTLDRKKK NFTFSRKFPF MKSRDEKNED GSDQEPFMLC
760 770 780 790 800
YTQDDANAEG ASEENVLSYE AVQRLSINYT RPVIILGPLK DRINDDLISE
810 820 830 840 850
YPDKFGSCVP HTTRPKREYE VDGRDYHFVS SREQMERDIQ NHLFIEAGQY
860 870 880 890 900
NDNLYGTSVA SVREVAEKGK HCILDVSGNA IKRLQVAQLY PVAVFIKPKS
910 920 930 940 950
VDSVMEMNRR MTEEQAKKTY ERAIKMEQEF GEYFTGVVQG DTIEEIYSKV
960 970
KSMIWSQSGP TIWVPSKESL
Note: Contains the N-terminal domain essential for correct neuronal development.
Length:970
Mass (Da):106,673
Last modified:August 31, 2004 - v2
Checksum:i544D1E1AD03B0674
GO
Isoform A (identifier: P31007-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERV → MTTRKKKRDGGGSGGGFIKKVSSLFNLDSLHKASSTK
     38-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

Note: No experimental confirmation available.
Show »
Length:968
Mass (Da):103,239
Checksum:iE641D9BE7669331C
GO
Isoform E (identifier: P31007-1) [UniParc]FASTAAdd to basket
Also known as: Dlg-A, D

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
     30-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

Show »
Length:960
Mass (Da):102,386
Checksum:i26E9B6026226BDA3
GO
Isoform F (identifier: P31007-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPVKKQE → MDSDTDSERE...EEERIADIQK
     473-519: EPGSRYASTN...QKGPQGLGFN → AFMLCYTQDD...NDADYRKSSI
     520-970: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:816
Mass (Da):88,662
Checksum:i35894E1555DE5AAE
GO
Isoform G (identifier: P31007-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
     30-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     746-746: P → PNGVVSSTSEIDINNVNNNQSNEPQP

Note: No experimental confirmation available.
Show »
Length:975
Mass (Da):104,016
Checksum:i15D466336AA4194C
GO
Isoform H (identifier: P31007-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:911
Mass (Da):100,171
Checksum:i47ACCA6E52AD1168
GO
Isoform I (identifier: P31007-7) [UniParc]FASTAAdd to basket
Also known as: C, J

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.
     206-267: VNGDDSWLYE...ADGRLSINDI → SQIQIQSLTQ...KMLKRAFEST
     268-970: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:208
Mass (Da):24,378
Checksum:iBB8F4B44E9DE2562
GO
Isoform K (identifier: P31007-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MPVKKQEAHR...KDGQAVKIAD → MIDWVSIVRH...GSRYACCCAN
     93-151: Missing.

Note: No experimental confirmation available.
Show »
Length:911
Mass (Da):100,458
Checksum:i6FE13A27211F2122
GO
Isoform L (identifier: P31007-8) [UniParc]FASTAAdd to basket
Also known as: S97

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.
     205-205: T → TLHKASSTK
     761-761: A → GEIIYRVELPDMEQITLIYLENNDADYP

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:946
Mass (Da):104,263
Checksum:i6BAFDD6BE66191B7
GO

Sequence cautioni

The sequence AAL39553 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti365M → T in AAA28468 (PubMed:1651169).Curated1
Sequence conflicti365M → T in AAQ01226 (PubMed:12657668).Curated1
Sequence conflicti369A → R in AAA28468 (PubMed:1651169).Curated1
Sequence conflicti369A → R in AAQ01226 (PubMed:12657668).Curated1
Sequence conflicti395E → G in ACV53090 (Ref. 6) Curated1
Isoform E (identifier: P31007-1)
Sequence conflicti355S → D in AAA28468 (PubMed:1651169).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0394021 – 92MPVKK…VKIAD → MIDWVSIVRHSRRRFSNYVG SRSPVRMRRRRRQLTAPPPQ QQQQQHYHQQQQQDQHQSRE RQKKDKEKEKETEKDNESGG GIGSRYACCCAN in isoform K. CuratedAdd BLAST92
Alternative sequenceiVSP_0114031 – 37MPVKK…AIERV → MTTRKKKRDGGGSGGGFIKK VSSLFNLDSLHKASSTK in isoform A. CuratedAdd BLAST37
Alternative sequenceiVSP_0114021 – 29MPVKK…PQDRA → MTTRKKKRDGGGSGGGFIKK VSSLFNLDS in isoform E and isoform G. 3 PublicationsAdd BLAST29
Alternative sequenceiVSP_0114011 – 7MPVKKQE → MDSDTDSEREKSSDPNEGLL SSDDKTFHDDDEPAEDSSPA DDEEEPEEEECLLPQKKAQI RCDQDQPPLVVLVQPSAEAI EVRQEIDDTNPVAVAAKASD MDGDSQLEVMEHQMETVTEP DPEPPKCPTSLRDSVRESVE CFYSAQDLLEYGHMLSSTSM VRTPDVESGYFEKSESDASR DEWEGPSSSSSGAARCRLLS GISGLSVSSSSRHSAEGLRM ELSRFRTMIETLERESLEKS QSELQLKAKSKAKPKPKQRS HVQDAAGESGSEQGSERGFW STIFGQAGLAISQDEEERIA DIQK in isoform F. 2 Publications7
Alternative sequenceiVSP_01140430 – 205Missing in isoform E and isoform G. 3 PublicationsAdd BLAST176
Alternative sequenceiVSP_01140538 – 205Missing in isoform A. CuratedAdd BLAST168
Alternative sequenceiVSP_01140693 – 151Missing in isoform I, isoform H, isoform K and isoform L. 2 PublicationsAdd BLAST59
Alternative sequenceiVSP_011407205T → TLHKASSTK in isoform L. 1 Publication1
Alternative sequenceiVSP_011408206 – 267VNGDD…SINDI → SQIQIQSLTQTYPNAHQRKR VLVSLHPHQHQHQSQIQHQH HYQLRHNNGIQAKMLKRAFE ST in isoform I. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_011409268 – 970Missing in isoform I. 2 PublicationsAdd BLAST703
Alternative sequenceiVSP_011411473 – 519EPGSR…GLGFN → AFMLCYTQDDANAEGGEIIY RVELPDMEQITLIYLENNDA DYRKSSI in isoform F. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_011410473E → GALNSMGQTVVDSPSIPQAA AAVAAAANASASASVIASNN TISNTTVTTVTATATASNSS SKLPPSLGANSSISISNSNS NSNSNNINNINSINNNNSSS SSTTATVAAATPTAASAAAA AASSPPANSFYNNASMPALP VESNQTNNRSQSPQPRQ in isoform A, isoform E and isoform G. 3 Publications1
Alternative sequenceiVSP_011412520 – 970Missing in isoform F. 2 PublicationsAdd BLAST451
Alternative sequenceiVSP_011413746P → PNGVVSSTSEIDINNVNNNQ SNEPQP in isoform G. 2 Publications1
Alternative sequenceiVSP_011414747 – 761FMLCY…NAEGA → NGVVSSTSEIDINNVNNNQS NEPQP in isoform A and isoform E. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_011415761A → GEIIYRVELPDMEQITLIYL ENNDADYP in isoform L. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M73529 mRNA Translation: AAA28468.1
AY332243 mRNA Translation: AAQ01226.1
AE014298 Genomic DNA Translation: AAF48037.2
AE014298 Genomic DNA Translation: AAF48038.2
AE014298 Genomic DNA Translation: AAF48039.2
AE014298 Genomic DNA Translation: AAN09630.1
AE014298 Genomic DNA Translation: AAS65308.1
AE014298 Genomic DNA Translation: AAS65309.1
AE014298 Genomic DNA Translation: AAS65310.1
AE014298 Genomic DNA Translation: AAS65311.1
AE014298 Genomic DNA Translation: AAS65312.1
AE014298 Genomic DNA Translation: AAS65313.1
AE014298 Genomic DNA Translation: ABW09394.1
AE014298 Genomic DNA Translation: ABW09395.1
AY059433 mRNA Translation: AAL13339.1
AY069408 mRNA Translation: AAL39553.1 Different initiation.
AY075410 mRNA Translation: AAL68235.1
BT099726 mRNA Translation: ACV53090.1
PIRiA39651
RefSeqiNP_001096955.1, NM_001103485.3 [P31007-9]
NP_001096956.1, NM_001103486.3 [P31007-8]
NP_001162719.1, NM_001169248.2 [P31007-1]
NP_001245623.1, NM_001258694.2 [P31007-5]
NP_001259447.1, NM_001272518.1 [P31007-1]
NP_511120.2, NM_078565.5 [P31007-1]
NP_727518.1, NM_167280.2 [P31007-7]
NP_727519.1, NM_167281.2 [P31007-4]
NP_727520.1, NM_167282.4 [P31007-3]
NP_996402.1, NM_206679.2 [P31007-7]
NP_996403.1, NM_206680.2 [P31007-7]
NP_996404.1, NM_206681.4 [P31007-6]
NP_996405.1, NM_206682.4 [P31007-5]
NP_996406.1, NM_206683.4 [P31007-2]
NP_996407.1, NM_206684.4 [P31007-1]
UniGeneiDm.4352

Genome annotation databases

EnsemblMetazoaiFBtr0073483; FBpp0073339; FBgn0001624 [P31007-7]
FBtr0073484; FBpp0073340; FBgn0001624 [P31007-4]
FBtr0073485; FBpp0073341; FBgn0001624 [P31007-1]
FBtr0073486; FBpp0073342; FBgn0001624 [P31007-3]
FBtr0073487; FBpp0089350; FBgn0001624 [P31007-1]
FBtr0073488; FBpp0089351; FBgn0001624 [P31007-2]
FBtr0073489; FBpp0089352; FBgn0001624 [P31007-5]
FBtr0073490; FBpp0089353; FBgn0001624 [P31007-6]
FBtr0073491; FBpp0089348; FBgn0001624 [P31007-7]
FBtr0073492; FBpp0089349; FBgn0001624 [P31007-7]
FBtr0112812; FBpp0111724; FBgn0001624 [P31007-9]
FBtr0112813; FBpp0111725; FBgn0001624 [P31007-8]
FBtr0301289; FBpp0290504; FBgn0001624 [P31007-1]
FBtr0308089; FBpp0300432; FBgn0001624 [P31007-5]
FBtr0333261; FBpp0305459; FBgn0001624 [P31007-1]
GeneIDi32083
KEGGidme:Dmel_CG1725
UCSCiCG1725-RE d. melanogaster
CG1725-RI d. melanogaster
CG1725-RK d. melanogaster
CG1725-RL d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDLG1_DROME
AccessioniPrimary (citable) accession number: P31007
Secondary accession number(s): A4V4A8
, A4V4B0, A8JUR9, A8JUS0, C7LAH6, Q7KV38, Q7KV39, Q7KV40, Q7YXH8, Q8SY37, Q8T0C6, Q95TF5, Q9VYZ4, Q9VYZ5, Q9VYZ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: August 31, 2004
Last modified: July 18, 2018
This is version 204 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health