Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 216 (16 Oct 2019)
Sequence version 2 (31 Aug 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disks large 1 tumor suppressor protein

Gene

dlg1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

During embryonic development, some isoforms are essential for proper neuronal differentiation and organization. Required for cell polarity; maintenance of apicobasal polarity. Plays a critical role at septate junctions in cellular growth control during larval development. The presence of a guanylate kinase domain suggests involvement in cellular adhesion as well as signal transduction to control cellular proliferation.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Transducer
Biological processCell adhesion, Differentiation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-DME-451308 Activation of Ca-permeable Kainate Receptor
R-DME-5625900 RHO GTPases activate CIT
R-DME-6794361 Neurexins and neuroligins
R-DME-8849932 Synaptic adhesion-like molecules

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P31007

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large 1 tumor suppressor protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:dlg1
Synonyms:l(1)dlg1
ORF Names:CG1725
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0001624 dlg1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945381 – 970Disks large 1 tumor suppressor proteinAdd BLAST970

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei496Phosphoserine1 Publication1
Modified residuei714Phosphothreonine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P31007

PRoteomics IDEntifications database

More...
PRIDEi
P31007

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P31007

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

During the cellular blastoderm stage, isoform B, isoform F, isoform H, isoform I and isoform L expression is localized to the cell borders. From stage 11 onwards, expression is found predominantly in the developing nervous system: axon bundles in the ventral cord and the brain. Stage 14 and 15 embryos exhibit expression in the developing body wall muscle. Expression in neuropil regions of the CNS and at NMJs persists through to larval development. Other isoforms show expression in embryonic epithelial cells. In larvae, expression is seen as a belt around salivary glands, imaginal disks and proventriculus. Expressed in adult reproductive tissues. In epithelia, coexpressed with scrib throughout development.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed both maternally and zygotically throughout development.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0001624 Expressed in 26 organ(s), highest expression level in head

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P31007 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P31007 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
58494, 52 interactors

Database of interacting proteins

More...
DIPi
DIP-31531N

Protein interaction database and analysis system

More...
IntActi
P31007, 44 interactors

Molecular INTeraction database

More...
MINTi
P31007

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1970
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P31007

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 64L27PROSITE-ProRule annotationAdd BLAST61
Domaini216 – 303PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini330 – 421PDZ 2PROSITE-ProRule annotationAdd BLAST92
Domaini506 – 587PDZ 3PROSITE-ProRule annotationAdd BLAST82
Domaini620 – 690SH3PROSITE-ProRule annotationAdd BLAST71
Domaini780 – 955Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708 Eukaryota
COG0194 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000167723

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P31007

KEGG Orthology (KO)

More...
KOi
K12076

Identification of Orthologs from Complete Genome Data

More...
OMAi
DDDWWTA

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P31007

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016313 DLG1-like
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF00595 PDZ, 3 hits
PF00018 SH3_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001741 MAGUK_DLGH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: P31007-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVKKQEAHR ALELLEDYHA RLSEPQDRAL RIAIERVIRI FKSRLFQALL
60 70 80 90 100
DIQEFYELTL LDDSKSIQQK TAETLQIATK WEKDGQAVKI ADFIKSSNLN
110 120 130 140 150
RNCAYEFNND ASSNQTNQSA LNQNPIANNV SAQAQAEALS RTFKSELEEI
160 170 180 190 200
LNQRMRIESD TENAKEPTVE QQQKQQQAQQ RSSRSPQQQN PQQQQGSKSR
210 220 230 240 250
SGSQTVNGDD SWLYEDIQLE RGNSGLGFSI AGGTDNPHIG TDTSIYITKL
260 270 280 290 300
ISGGAAAADG RLSINDIIVS VNDVSVVDVP HASAVDALKK AGNVVKLHVK
310 320 330 340 350
RKRGTATTPA AGSAAGDARD SAASGPKVIE IDLVKGGKGL GFSIAGGIGN
360 370 380 390 400
QHIPGDNGIY VTKLMDGGAA QVDGRLSIGD KLIAVRTNGS EKNLENVTHE
410 420 430 440 450
LAVATLKSIT DKVTLIIGKT QHLTTSASGG GGGGLSSGQQ LSQSQSQLAT
460 470 480 490 500
SQSQSQVHQQ QHATPMVNSQ STEPGSRYAS TNVLAAVPPG TPRAVSTEDI
510 520 530 540 550
TREPRTITIQ KGPQGLGFNI VGGEDGQGIY VSFILAGGPA DLGSELKRGD
560 570 580 590 600
QLLSVNNVNL THATHEEAAQ ALKTSGGVVT LLAQYRPEEY NRFEARIQEL
610 620 630 640 650
KQQAALGAGG SGTLLRTTQK RSLYVRALFD YDPNRDDGLP SRGLPFKHGD
660 670 680 690 700
ILHVTNASDD EWWQARRVLG DNEDEQIGIV PSKRRWERKM RARDRSVKFQ
710 720 730 740 750
GHAAANNNLD KQSTLDRKKK NFTFSRKFPF MKSRDEKNED GSDQEPFMLC
760 770 780 790 800
YTQDDANAEG ASEENVLSYE AVQRLSINYT RPVIILGPLK DRINDDLISE
810 820 830 840 850
YPDKFGSCVP HTTRPKREYE VDGRDYHFVS SREQMERDIQ NHLFIEAGQY
860 870 880 890 900
NDNLYGTSVA SVREVAEKGK HCILDVSGNA IKRLQVAQLY PVAVFIKPKS
910 920 930 940 950
VDSVMEMNRR MTEEQAKKTY ERAIKMEQEF GEYFTGVVQG DTIEEIYSKV
960 970
KSMIWSQSGP TIWVPSKESL
Note: Contains the N-terminal domain essential for correct neuronal development.
Length:970
Mass (Da):106,673
Last modified:August 31, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i544D1E1AD03B0674
GO
Isoform A (identifier: P31007-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERV → MTTRKKKRDGGGSGGGFIKKVSSLFNLDSLHKASSTK
     38-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

Note: No experimental confirmation available.
Show »
Length:968
Mass (Da):103,239
Checksum:iE641D9BE7669331C
GO
Isoform E (identifier: P31007-1) [UniParc]FASTAAdd to basket
Also known as: Dlg-A, D

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
     30-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     747-761: FMLCYTQDDANAEGA → NGVVSSTSEIDINNVNNNQSNEPQP

Show »
Length:960
Mass (Da):102,386
Checksum:i26E9B6026226BDA3
GO
Isoform F (identifier: P31007-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-7: MPVKKQE → MDSDTDSERE...EEERIADIQK
     473-519: EPGSRYASTN...QKGPQGLGFN → AFMLCYTQDD...NDADYRKSSI
     520-970: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:816
Mass (Da):88,662
Checksum:i35894E1555DE5AAE
GO
Isoform G (identifier: P31007-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MPVKKQEAHRALELLEDYHARLSEPQDRA → MTTRKKKRDGGGSGGGFIKKVSSLFNLDS
     30-205: Missing.
     473-473: E → GALNSMGQTV...NRSQSPQPRQ
     746-746: P → PNGVVSSTSEIDINNVNNNQSNEPQP

Note: No experimental confirmation available.
Show »
Length:975
Mass (Da):104,016
Checksum:i15D466336AA4194C
GO
Isoform H (identifier: P31007-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:911
Mass (Da):100,171
Checksum:i47ACCA6E52AD1168
GO
Isoform I (identifier: P31007-7) [UniParc]FASTAAdd to basket
Also known as: C, J

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.
     206-267: VNGDDSWLYE...ADGRLSINDI → SQIQIQSLTQ...KMLKRAFEST
     268-970: Missing.

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:208
Mass (Da):24,378
Checksum:iBB8F4B44E9DE2562
GO
Isoform K (identifier: P31007-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: MPVKKQEAHR...KDGQAVKIAD → MIDWVSIVRH...GSRYACCCAN
     93-151: Missing.

Note: No experimental confirmation available.
Show »
Length:911
Mass (Da):100,458
Checksum:i6FE13A27211F2122
GO
Isoform L (identifier: P31007-8) [UniParc]FASTAAdd to basket
Also known as: S97

The sequence of this isoform differs from the canonical sequence as follows:
     93-151: Missing.
     205-205: T → TLHKASSTK
     761-761: A → GEIIYRVELPDMEQITLIYLENNDADYP

Note: Contains the N-terminal domain essential for correct neuronal development.
Show »
Length:946
Mass (Da):104,263
Checksum:i6BAFDD6BE66191B7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E8NH13E8NH13_DROME
Discs large 1, isoform P
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
983Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E1JJH5E1JJH5_DROME
Discs large 1, isoform M
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
1,030Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E1JJH6E1JJH6_DROME
Discs large 1, isoform N
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
960Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PHK8M9PHK8_DROME
Discs large 1, isoform R
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
1,001Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NGZ2M9NGZ2_DROME
Discs large 1, isoform Q
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
975Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C1C536C1C536_DROME
Discs large 1, isoform O
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
206Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PJI4M9PJI4_DROME
Discs large 1, isoform T
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
943Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PEB3M9PEB3_DROME
Discs large 1, isoform U
dlg1 11, anon-EST:Posey93, anon-WO03040301.258, anon-WO03040301.260, anon-WO03040301.268
198Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL39553 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti365M → T in AAA28468 (PubMed:1651169).Curated1
Sequence conflicti365M → T in AAQ01226 (PubMed:12657668).Curated1
Sequence conflicti369A → R in AAA28468 (PubMed:1651169).Curated1
Sequence conflicti369A → R in AAQ01226 (PubMed:12657668).Curated1
Sequence conflicti395E → G in ACV53090 (Ref. 6) Curated1
Isoform E (identifier: P31007-1)
Sequence conflicti355S → D in AAA28468 (PubMed:1651169).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0394021 – 92MPVKK…VKIAD → MIDWVSIVRHSRRRFSNYVG SRSPVRMRRRRRQLTAPPPQ QQQQQHYHQQQQQDQHQSRE RQKKDKEKEKETEKDNESGG GIGSRYACCCAN in isoform K. CuratedAdd BLAST92
Alternative sequenceiVSP_0114031 – 37MPVKK…AIERV → MTTRKKKRDGGGSGGGFIKK VSSLFNLDSLHKASSTK in isoform A. CuratedAdd BLAST37
Alternative sequenceiVSP_0114021 – 29MPVKK…PQDRA → MTTRKKKRDGGGSGGGFIKK VSSLFNLDS in isoform E and isoform G. 3 PublicationsAdd BLAST29
Alternative sequenceiVSP_0114011 – 7MPVKKQE → MDSDTDSEREKSSDPNEGLL SSDDKTFHDDDEPAEDSSPA DDEEEPEEEECLLPQKKAQI RCDQDQPPLVVLVQPSAEAI EVRQEIDDTNPVAVAAKASD MDGDSQLEVMEHQMETVTEP DPEPPKCPTSLRDSVRESVE CFYSAQDLLEYGHMLSSTSM VRTPDVESGYFEKSESDASR DEWEGPSSSSSGAARCRLLS GISGLSVSSSSRHSAEGLRM ELSRFRTMIETLERESLEKS QSELQLKAKSKAKPKPKQRS HVQDAAGESGSEQGSERGFW STIFGQAGLAISQDEEERIA DIQK in isoform F. 2 Publications7
Alternative sequenceiVSP_01140430 – 205Missing in isoform E and isoform G. 3 PublicationsAdd BLAST176
Alternative sequenceiVSP_01140538 – 205Missing in isoform A. CuratedAdd BLAST168
Alternative sequenceiVSP_01140693 – 151Missing in isoform I, isoform H, isoform K and isoform L. 2 PublicationsAdd BLAST59
Alternative sequenceiVSP_011407205T → TLHKASSTK in isoform L. 1 Publication1
Alternative sequenceiVSP_011408206 – 267VNGDD…SINDI → SQIQIQSLTQTYPNAHQRKR VLVSLHPHQHQHQSQIQHQH HYQLRHNNGIQAKMLKRAFE ST in isoform I. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_011409268 – 970Missing in isoform I. 2 PublicationsAdd BLAST703
Alternative sequenceiVSP_011411473 – 519EPGSR…GLGFN → AFMLCYTQDDANAEGGEIIY RVELPDMEQITLIYLENNDA DYRKSSI in isoform F. 2 PublicationsAdd BLAST47
Alternative sequenceiVSP_011410473E → GALNSMGQTVVDSPSIPQAA AAVAAAANASASASVIASNN TISNTTVTTVTATATASNSS SKLPPSLGANSSISISNSNS NSNSNNINNINSINNNNSSS SSTTATVAAATPTAASAAAA AASSPPANSFYNNASMPALP VESNQTNNRSQSPQPRQ in isoform A, isoform E and isoform G. 3 Publications1
Alternative sequenceiVSP_011412520 – 970Missing in isoform F. 2 PublicationsAdd BLAST451
Alternative sequenceiVSP_011413746P → PNGVVSSTSEIDINNVNNNQ SNEPQP in isoform G. 2 Publications1
Alternative sequenceiVSP_011414747 – 761FMLCY…NAEGA → NGVVSSTSEIDINNVNNNQS NEPQP in isoform A and isoform E. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_011415761A → GEIIYRVELPDMEQITLIYL ENNDADYP in isoform L. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M73529 mRNA Translation: AAA28468.1
AY332243 mRNA Translation: AAQ01226.1
AE014298 Genomic DNA Translation: AAF48037.2
AE014298 Genomic DNA Translation: AAF48038.2
AE014298 Genomic DNA Translation: AAF48039.2
AE014298 Genomic DNA Translation: AAN09630.1
AE014298 Genomic DNA Translation: AAS65308.1
AE014298 Genomic DNA Translation: AAS65309.1
AE014298 Genomic DNA Translation: AAS65310.1
AE014298 Genomic DNA Translation: AAS65311.1
AE014298 Genomic DNA Translation: AAS65312.1
AE014298 Genomic DNA Translation: AAS65313.1
AE014298 Genomic DNA Translation: ABW09394.1
AE014298 Genomic DNA Translation: ABW09395.1
AY059433 mRNA Translation: AAL13339.1
AY069408 mRNA Translation: AAL39553.1 Different initiation.
AY075410 mRNA Translation: AAL68235.1
BT099726 mRNA Translation: ACV53090.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A39651

NCBI Reference Sequences

More...
RefSeqi
NP_001096955.1, NM_001103485.3 [P31007-9]
NP_001096956.1, NM_001103486.3 [P31007-8]
NP_001162719.1, NM_001169248.2 [P31007-1]
NP_001245623.1, NM_001258694.2 [P31007-5]
NP_001259447.1, NM_001272518.1 [P31007-1]
NP_511120.2, NM_078565.5 [P31007-1]
NP_727518.1, NM_167280.2 [P31007-7]
NP_727519.1, NM_167281.2 [P31007-4]
NP_727520.1, NM_167282.4 [P31007-3]
NP_996402.1, NM_206679.2 [P31007-7]
NP_996403.1, NM_206680.2 [P31007-7]
NP_996404.1, NM_206681.4 [P31007-6]
NP_996405.1, NM_206682.4 [P31007-5]
NP_996406.1, NM_206683.4 [P31007-2]
NP_996407.1, NM_206684.4 [P31007-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0073483; FBpp0073339; FBgn0001624 [P31007-7]
FBtr0073484; FBpp0073340; FBgn0001624 [P31007-4]
FBtr0073485; FBpp0073341; FBgn0001624 [P31007-1]
FBtr0073486; FBpp0073342; FBgn0001624 [P31007-3]
FBtr0073487; FBpp0089350; FBgn0001624 [P31007-1]
FBtr0073488; FBpp0089351; FBgn0001624 [P31007-2]
FBtr0073489; FBpp0089352; FBgn0001624 [P31007-5]
FBtr0073490; FBpp0089353; FBgn0001624 [P31007-6]
FBtr0073491; FBpp0089348; FBgn0001624 [P31007-7]
FBtr0073492; FBpp0089349; FBgn0001624 [P31007-7]
FBtr0112812; FBpp0111724; FBgn0001624 [P31007-9]
FBtr0112813; FBpp0111725; FBgn0001624 [P31007-8]
FBtr0301289; FBpp0290504; FBgn0001624 [P31007-1]
FBtr0308089; FBpp0300432; FBgn0001624 [P31007-5]
FBtr0333261; FBpp0305459; FBgn0001624 [P31007-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
32083

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG1725

UCSC genome browser

More...
UCSCi
CG1725-RE d. melanogaster
CG1725-RI d. melanogaster
CG1725-RK d. melanogaster
CG1725-RL d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M73529 mRNA Translation: AAA28468.1
AY332243 mRNA Translation: AAQ01226.1
AE014298 Genomic DNA Translation: AAF48037.2
AE014298 Genomic DNA Translation: AAF48038.2
AE014298 Genomic DNA Translation: AAF48039.2
AE014298 Genomic DNA Translation: AAN09630.1
AE014298 Genomic DNA Translation: AAS65308.1
AE014298 Genomic DNA Translation: AAS65309.1
AE014298 Genomic DNA Translation: AAS65310.1
AE014298 Genomic DNA Translation: AAS65311.1
AE014298 Genomic DNA Translation: AAS65312.1
AE014298 Genomic DNA Translation: AAS65313.1
AE014298 Genomic DNA Translation: ABW09394.1
AE014298 Genomic DNA Translation: ABW09395.1
AY059433 mRNA Translation: AAL13339.1
AY069408 mRNA Translation: AAL39553.1 Different initiation.
AY075410 mRNA Translation: AAL68235.1
BT099726 mRNA Translation: ACV53090.1
PIRiA39651
RefSeqiNP_001096955.1, NM_001103485.3 [P31007-9]
NP_001096956.1, NM_001103486.3 [P31007-8]
NP_001162719.1, NM_001169248.2 [P31007-1]
NP_001245623.1, NM_001258694.2 [P31007-5]
NP_001259447.1, NM_001272518.1 [P31007-1]
NP_511120.2, NM_078565.5 [P31007-1]
NP_727518.1, NM_167280.2 [P31007-7]
NP_727519.1, NM_167281.2 [P31007-4]
NP_727520.1, NM_167282.4 [P31007-3]
NP_996402.1, NM_206679.2 [P31007-7]
NP_996403.1, NM_206680.2 [P31007-7]
NP_996404.1, NM_206681.4 [P31007-6]
NP_996405.1, NM_206682.4 [P31007-5]
NP_996406.1, NM_206683.4 [P31007-2]
NP_996407.1, NM_206684.4 [P31007-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3TVTX-ray1.60A618-970[»]
4RP3X-ray1.36A/B1-97[»]
4RP4X-ray1.42A/B1-97[»]
4RP5X-ray1.65A/B1-97[»]
SMRiP31007
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi58494, 52 interactors
DIPiDIP-31531N
IntActiP31007, 44 interactors
MINTiP31007

PTM databases

iPTMnetiP31007

Proteomic databases

PaxDbiP31007
PRIDEiP31007

Genome annotation databases

EnsemblMetazoaiFBtr0073483; FBpp0073339; FBgn0001624 [P31007-7]
FBtr0073484; FBpp0073340; FBgn0001624 [P31007-4]
FBtr0073485; FBpp0073341; FBgn0001624 [P31007-1]
FBtr0073486; FBpp0073342; FBgn0001624 [P31007-3]
FBtr0073487; FBpp0089350; FBgn0001624 [P31007-1]
FBtr0073488; FBpp0089351; FBgn0001624 [P31007-2]
FBtr0073489; FBpp0089352; FBgn0001624 [P31007-5]
FBtr0073490; FBpp0089353; FBgn0001624 [P31007-6]
FBtr0073491; FBpp0089348; FBgn0001624 [P31007-7]
FBtr0073492; FBpp0089349; FBgn0001624 [P31007-7]
FBtr0112812; FBpp0111724; FBgn0001624 [P31007-9]
FBtr0112813; FBpp0111725; FBgn0001624 [P31007-8]
FBtr0301289; FBpp0290504; FBgn0001624 [P31007-1]
FBtr0308089; FBpp0300432; FBgn0001624 [P31007-5]
FBtr0333261; FBpp0305459; FBgn0001624 [P31007-1]
GeneIDi32083
KEGGidme:Dmel_CG1725
UCSCiCG1725-RE d. melanogaster
CG1725-RI d. melanogaster
CG1725-RK d. melanogaster
CG1725-RL d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1739
FlyBaseiFBgn0001624 dlg1

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00940000167723
InParanoidiP31007
KOiK12076
OMAiDDDWWTA
PhylomeDBiP31007

Enzyme and pathway databases

ReactomeiR-DME-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-DME-451308 Activation of Ca-permeable Kainate Receptor
R-DME-5625900 RHO GTPases activate CIT
R-DME-6794361 Neurexins and neuroligins
R-DME-8849932 Synaptic adhesion-like molecules
SignaLinkiP31007

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
dlg1 fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
32083

Protein Ontology

More...
PROi
PR:P31007

Gene expression databases

BgeeiFBgn0001624 Expressed in 26 organ(s), highest expression level in head
ExpressionAtlasiP31007 baseline and differential
GenevisibleiP31007 DM

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR015143 L27_1
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF09058 L27_1, 1 hit
PF00595 PDZ, 3 hits
PF00018 SH3_1, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLG1_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P31007
Secondary accession number(s): A4V4A8
, A4V4B0, A8JUR9, A8JUS0, C7LAH6, Q7KV38, Q7KV39, Q7KV40, Q7YXH8, Q8SY37, Q8T0C6, Q95TF5, Q9VYZ4, Q9VYZ5, Q9VYZ6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: August 31, 2004
Last modified: October 16, 2019
This is version 216 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again