Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 158 (16 Oct 2019)
Sequence version 3 (25 Nov 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Probable V-type proton ATPase 116 kDa subunit a

Gene

unc-32

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle (Probable). Regulates the size of gut granules during embryonic development (PubMed:20148972).Curated1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processHydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-1222556 ROS and RNS production in phagocytes
R-CEL-6798695 Neutrophil degranulation
R-CEL-77387 Insulin receptor recycling
R-CEL-917977 Transferrin endocytosis and recycling
R-CEL-983712 Ion channel transport

Protein family/group databases

Transport Classification Database

More...
TCDBi
3.A.2.2.7 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable V-type proton ATPase 116 kDa subunit a
Short name:
V-ATPase 116 kDa isoform a
Alternative name(s):
Uncoordinated protein 32
Vacuolar proton translocating ATPase 116 kDa subunit a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:unc-32
ORF Names:ZK637.8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome III

Organism-specific databases

WormBase

More...
WormBasei
ZK637.8a ; CE30573 ; WBGene00006768 ; unc-32
ZK637.8b ; CE30574 ; WBGene00006768 ; unc-32
ZK637.8c ; CE30575 ; WBGene00006768 ; unc-32
ZK637.8d ; CE30576 ; WBGene00006768 ; unc-32
ZK637.8e ; CE30577 ; WBGene00006768 ; unc-32
ZK637.8f ; CE30578 ; WBGene00006768 ; unc-32

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 424CytoplasmicSequence analysisAdd BLAST424
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei425 – 443HelicalSequence analysisAdd BLAST19
Topological domaini444 – 445VacuolarSequence analysis2
Transmembranei446 – 462HelicalSequence analysisAdd BLAST17
Topological domaini463 – 477CytoplasmicSequence analysisAdd BLAST15
Transmembranei478 – 507HelicalSequence analysisAdd BLAST30
Topological domaini508 – 572VacuolarSequence analysisAdd BLAST65
Transmembranei573 – 592HelicalSequence analysisAdd BLAST20
Topological domaini593 – 610CytoplasmicSequence analysisAdd BLAST18
Transmembranei611 – 631HelicalSequence analysisAdd BLAST21
Topological domaini632 – 699VacuolarSequence analysisAdd BLAST68
Transmembranei700 – 719HelicalSequence analysisAdd BLAST20
Topological domaini720 – 788CytoplasmicSequence analysisAdd BLAST69
Transmembranei789 – 813HelicalSequence analysisAdd BLAST25
Topological domaini814 – 834VacuolarSequence analysisAdd BLAST21
Transmembranei835 – 873HelicalSequence analysisAdd BLAST39
Topological domaini874 – 905CytoplasmicSequence analysisAdd BLAST32

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001192211 – 905Probable V-type proton ATPase 116 kDa subunit aAdd BLAST905

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P30628

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P30628

PeptideAtlas

More...
PeptideAtlasi
P30628

PRoteomics IDEntifications database

More...
PRIDEi
P30628

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P30628

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous expression in embryos. Expressed in gonads, intestine, neurons in the head and motoneurons in the ventral cord of larvae and adults. Expression of isoform c and isoform f is restricted to the nervous system.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in embryos, larvae and adult. Highest level of expression is in early embryos.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00006768 Expressed in 9 organ(s), highest expression level in multi-cellular organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
41458, 5 interactors

STRING: functional protein association networks

More...
STRINGi
6239.ZK637.8a

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the V-ATPase 116 kDa subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2189 Eukaryota
COG1269 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182881

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P30628

KEGG Orthology (KO)

More...
KOi
K02154

Identification of Orthologs from Complete Genome Data

More...
OMAi
LIYMFLQ

Database of Orthologous Groups

More...
OrthoDBi
181796at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P30628

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002490 V-ATPase_116kDa_su
IPR026028 V-type_ATPase_116kDa_su_euka

The PANTHER Classification System

More...
PANTHERi
PTHR11629 PTHR11629, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01496 V_ATPase_I, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001293 ATP6V0A1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: P30628-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDYVTPGEE PPQPGIYRSE QMCLAQLYLQ SDASYQCVAE LGELGLVQFR
60 70 80 90 100
DLNPDVSSFQ RKYVNEVRRC DEMERKLRYL EREIKKDQIP MLDTGENPDA
110 120 130 140 150
PLPREMIDLE ATFEKLENEL REVNKNEETL KKNFSELTEL KHILRKTQTF
160 170 180 190 200
FEEVDHDRWR ILEGGSGRRG RSTEREETRP LIDIGDMDDD SAARMSAQAA
210 220 230 240 250
MLRLGFVAGV IQRERLPAFE RLLWRACRGN VFLRTSEIDD VLNDTVTGDP
260 270 280 290 300
VNKCVFIIFF QGDHLKTKVK KICEGFRATL YPCPDTPQER REMSIGVMTR
310 320 330 340 350
IEDLKTVLGQ TQDHRHRVLV AASKNVRMWL TKVRKIKSIY HTLNLFNIDV
360 370 380 390 400
TQKCLIAEVW CPIAELDRIK MALKRGTDES GSQVPSILNR METNEAPPTY
410 420 430 440 450
NKTNKFTKGF QNIVDAYGIA TYREINPAPY TMISFPFLFA VMFGDMGHGA
460 470 480 490 500
IMLLAALFFI LKEKQLEAAR IKDEIFQTFF GGRYVIFLMG AFSIYTGFMY
510 520 530 540 550
NDVFSKSINT FGSSWQNTIP ESVIDYYLDD EKRSESQLIL PPETAFDGNP
560 570 580 590 600
YPIGVDPVWN LAEGNKLSFL NSMKMKMSVL FGIAQMTFGV LLSYQNFIYF
610 620 630 640 650
KSDLDIKYMF IPQMIFLSSI FIYLCIQILS KWLFFGAVGG TVLGYKYPGS
660 670 680 690 700
NCAPSLLIGL INMFMMKSRN AGFVDDSGET YPQCYLSTWY PGQATIEIIL
710 720 730 740 750
VVLALVQVPI MLFAKPYFLY RRDKQQSRYS TLTAESNQHQ SVRADINQDD
760 770 780 790 800
AEVVHAPEQT PKPSGHGHGH GDGPLEMGDV MVYQAIHTIE FVLGCVSHTA
810 820 830 840 850
SYLRLWALSL AHAQLSDVLW TMVFRNAFVL DGYTGAIATY ILFFIFGSLS
860 870 880 890 900
VFILVLMEGL SAFLHALRLH WVEFQSKFYG GLGYEFAPFS FEKILAEERE

AEENL
Length:905
Mass (Da):103,401
Last modified:November 25, 2002 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2B6647EB521A9FBC
GO
Isoform b (identifier: P30628-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     154-204: VDHDRWRILE...MSAQAAMLRL → AGTGEMLPPAAVESEEGLELTQHAAAGGATMFANF
     694-740: ATIEIILVVL...TLTAESNQHQ → SFFETIFVLV...ERREGGHRQL

Show »
Length:883
Mass (Da):100,486
Checksum:i53B3EB32FAD50219
GO
Isoform c (identifier: P30628-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     154-205: VDHDRWRILE...SAQAAMLRLG → HEDMIASSAE...AMSPLKLQLR

Show »
Length:894
Mass (Da):101,967
Checksum:iB8FDAEF1AB1C4EB4
GO
Isoform d (identifier: P30628-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     694-740: ATIEIILVVL...TLTAESNQHQ → SFFETIFVLV...ERREGGHRQL

Show »
Length:899
Mass (Da):102,779
Checksum:i0E04DAE84A3E9E21
GO
Isoform e (identifier: P30628-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     154-205: VDHDRWRILE...SAQAAMLRLG → HEDMIASSAE...AMSPLKLQLR
     694-740: ATIEIILVVL...TLTAESNQHQ → SFFETIFVLV...ERREGGHRQL

Show »
Length:888
Mass (Da):101,346
Checksum:i9F0C27ADBA2FE01D
GO
Isoform f (identifier: P30628-6) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     154-204: VDHDRWRILE...MSAQAAMLRL → AGTGEMLPPAAVESEEGLELTQHAAAGGATMFANF

Show »
Length:889
Mass (Da):101,107
Checksum:i07775266CA7A420B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000347154 – 205VDHDR…MLRLG → HEDMIASSAESSGIGEVLSA DEEELSGRFSDAMSPLKLQL R in isoform c and isoform e. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_000346154 – 204VDHDR…AMLRL → AGTGEMLPPAAVESEEGLEL TQHAAAGGATMFANF in isoform b and isoform f. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_000348694 – 740ATIEI…SNQHQ → SFFETIFVLVAIACVPVMLF GKPYFLWKEEKERREGGHRQ L in isoform b, isoform d and isoform e. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF320899 mRNA Translation: AAG41432.1
AF320900 mRNA Translation: AAG41433.1
AF320901 mRNA Translation: AAG41434.1
AF320902 mRNA Translation: AAG41435.1
AF320903 mRNA Translation: AAG41436.1
AF320904 mRNA Translation: AAG41437.1
Z11115 Genomic DNA Translation: CAA77448.2
Z11115 Genomic DNA Translation: CAA77453.2
Z11115 Genomic DNA Translation: CAD30450.1
Z11115 Genomic DNA Translation: CAD30451.1
Z11115 Genomic DNA Translation: CAD30452.1
Z11115 Genomic DNA Translation: CAD30453.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S15795

NCBI Reference Sequences

More...
RefSeqi
NP_001023017.1, NM_001027846.1 [P30628-1]
NP_001023018.1, NM_001027847.2 [P30628-2]
NP_001023019.1, NM_001027848.4 [P30628-3]
NP_001023020.1, NM_001027849.1 [P30628-4]
NP_001023021.1, NM_001027850.3 [P30628-5]
NP_001023022.1, NM_001027851.1 [P30628-6]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
ZK637.8a.1; ZK637.8a.1; WBGene00006768 [P30628-1]
ZK637.8b.1; ZK637.8b.1; WBGene00006768 [P30628-2]
ZK637.8c.1; ZK637.8c.1; WBGene00006768 [P30628-3]
ZK637.8d.1; ZK637.8d.1; WBGene00006768 [P30628-4]
ZK637.8e.1; ZK637.8e.1; WBGene00006768 [P30628-5]
ZK637.8f.1; ZK637.8f.1; WBGene00006768 [P30628-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
176257

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_ZK637.8

UCSC genome browser

More...
UCSCi
ZK637.8e c. elegans [P30628-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF320899 mRNA Translation: AAG41432.1
AF320900 mRNA Translation: AAG41433.1
AF320901 mRNA Translation: AAG41434.1
AF320902 mRNA Translation: AAG41435.1
AF320903 mRNA Translation: AAG41436.1
AF320904 mRNA Translation: AAG41437.1
Z11115 Genomic DNA Translation: CAA77448.2
Z11115 Genomic DNA Translation: CAA77453.2
Z11115 Genomic DNA Translation: CAD30450.1
Z11115 Genomic DNA Translation: CAD30451.1
Z11115 Genomic DNA Translation: CAD30452.1
Z11115 Genomic DNA Translation: CAD30453.1
PIRiS15795
RefSeqiNP_001023017.1, NM_001027846.1 [P30628-1]
NP_001023018.1, NM_001027847.2 [P30628-2]
NP_001023019.1, NM_001027848.4 [P30628-3]
NP_001023020.1, NM_001027849.1 [P30628-4]
NP_001023021.1, NM_001027850.3 [P30628-5]
NP_001023022.1, NM_001027851.1 [P30628-6]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi41458, 5 interactors
STRINGi6239.ZK637.8a

Protein family/group databases

TCDBi3.A.2.2.7 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

PTM databases

iPTMnetiP30628

Proteomic databases

EPDiP30628
PaxDbiP30628
PeptideAtlasiP30628
PRIDEiP30628

Genome annotation databases

EnsemblMetazoaiZK637.8a.1; ZK637.8a.1; WBGene00006768 [P30628-1]
ZK637.8b.1; ZK637.8b.1; WBGene00006768 [P30628-2]
ZK637.8c.1; ZK637.8c.1; WBGene00006768 [P30628-3]
ZK637.8d.1; ZK637.8d.1; WBGene00006768 [P30628-4]
ZK637.8e.1; ZK637.8e.1; WBGene00006768 [P30628-5]
ZK637.8f.1; ZK637.8f.1; WBGene00006768 [P30628-6]
GeneIDi176257
KEGGicel:CELE_ZK637.8
UCSCiZK637.8e c. elegans [P30628-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
176257
WormBaseiZK637.8a ; CE30573 ; WBGene00006768 ; unc-32
ZK637.8b ; CE30574 ; WBGene00006768 ; unc-32
ZK637.8c ; CE30575 ; WBGene00006768 ; unc-32
ZK637.8d ; CE30576 ; WBGene00006768 ; unc-32
ZK637.8e ; CE30577 ; WBGene00006768 ; unc-32
ZK637.8f ; CE30578 ; WBGene00006768 ; unc-32

Phylogenomic databases

eggNOGiKOG2189 Eukaryota
COG1269 LUCA
GeneTreeiENSGT00950000182881
InParanoidiP30628
KOiK02154
OMAiLIYMFLQ
OrthoDBi181796at2759
PhylomeDBiP30628

Enzyme and pathway databases

ReactomeiR-CEL-1222556 ROS and RNS production in phagocytes
R-CEL-6798695 Neutrophil degranulation
R-CEL-77387 Insulin receptor recycling
R-CEL-917977 Transferrin endocytosis and recycling
R-CEL-983712 Ion channel transport

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P30628

Gene expression databases

BgeeiWBGene00006768 Expressed in 9 organ(s), highest expression level in multi-cellular organism

Family and domain databases

InterProiView protein in InterPro
IPR002490 V-ATPase_116kDa_su
IPR026028 V-type_ATPase_116kDa_su_euka
PANTHERiPTHR11629 PTHR11629, 1 hit
PfamiView protein in Pfam
PF01496 V_ATPase_I, 1 hit
PIRSFiPIRSF001293 ATP6V0A1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVPP1_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P30628
Secondary accession number(s): Q23555
, Q9GPJ3, Q9GPJ4, Q9GPJ5, Q9GPJ6, Q9GPJ7, Q9GPJ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: November 25, 2002
Last modified: October 16, 2019
This is version 158 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again