Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P30613 (KPYR_HUMAN)

Entry version 238 (02 Jun 2021)
Sequence version 2 (30 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Pyruvate kinase PKLR

Gene

PKLR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a key role in glycolysis.

By similarity

Miscellaneous

There are 4 isozymes of pyruvate kinase in mammals: L, R, M1 and M2. L type is major isozyme in the liver, R is found in red cells, M1 is the main form in muscle, heart and brain, and M2 is found in early fetal tissues.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Allosterically activated by fructose 1,6-bisphosphate.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: glycolysis

This protein is involved in step 5 of the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate. This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei116SubstrateCombined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi118PotassiumCombined sources1 Publication1
Metal bindingi120PotassiumCombined sources1 Publication1
Metal bindingi156PotassiumCombined sources1 Publication1
Metal bindingi157Potassium; via carbonyl oxygenCombined sources1 Publication1
Binding sitei163ATPBy similarity1
Binding sitei250ATPBy similarity1
Binding sitei313Substrate; via amide nitrogenCombined sources1 Publication1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei313Transition state stabilizerBy similarity1
Metal bindingi315ManganeseCombined sources1 Publication1
Binding sitei338Substrate; via amide nitrogenCombined sources1 Publication1
Metal bindingi339ManganeseCombined sources1 Publication1
Binding sitei339Substrate; via amide nitrogenCombined sources1 Publication1
Binding sitei371SubstrateCombined sources1 Publication1
Binding sitei525Fructose-1,6-bisphosphate; allosteric activatorCombined sources1 Publication1
Binding sitei532Fructose-1,6-bisphosphate; allosteric activatorCombined sources1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi118 – 121ATPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAllosteric enzyme, Kinase, Transferase
Biological processGlycolysis
LigandATP-binding, Magnesium, Manganese, Metal-binding, Nucleotide-binding, Potassium, Pyruvate

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS07088-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.1.40, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P30613

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-163765, ChREBP activates metabolic gene expression [P30613-1]
R-HSA-210745, Regulation of gene expression in beta cells [P30613-2]
R-HSA-70171, Glycolysis

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P30613

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00109;UER00188

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pyruvate kinase PKLR (EC:2.7.1.40)
Alternative name(s):
Pyruvate kinase 1
Pyruvate kinase isozymes L/R
R-type/L-type pyruvate kinase
Red cell/liver pyruvate kinase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PKLR
Synonyms:PK1, PKL
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:9020, PKLR

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609712, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P30613

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000143627.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pyruvate kinase hyperactivity (PKHYP)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionAutosomal dominant phenotype characterized by increase of red blood cell ATP.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01143537G → E in PKHYP. 1 PublicationCorresponds to variant dbSNP:rs118204087EnsemblClinVar.1
Pyruvate kinase deficiency of red cells (PKRD)17 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA frequent cause of hereditary non-spherocytic hemolytic anemia. Clinically, pyruvate kinase-deficient patients suffer from a highly variable degree of chronic hemolysis, ranging from severe neonatal jaundice and fatal anemia at birth, severe transfusion-dependent chronic hemolysis, moderate hemolysis with exacerbation during infection, to a fully compensated hemolysis without apparent anemia.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05846740R → W in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1484388413Ensembl.1
Natural variantiVAR_05846848 – 53Missing in PKRD. 1 Publication6
Natural variantiVAR_05846973L → P in PKRD. 1 Publication1
Natural variantiVAR_01143680S → P in PKRD. 1
Natural variantiVAR_01143786R → P in PKRD. 1
Natural variantiVAR_01143890I → N in PKRD. 1 Publication1
Natural variantiVAR_01143995G → R in PKRD. Corresponds to variant dbSNP:rs750857114Ensembl.1
Natural variantiVAR_004028107M → T in PKRD. 1
Natural variantiVAR_011440111G → R in PKRD. 1 PublicationCorresponds to variant dbSNP:rs918627824EnsemblClinVar.1
Natural variantiVAR_011441115A → P in PKRD; Val de Marne. 1
Natural variantiVAR_011442120S → F in PKRD; Beaujon. 1
Natural variantiVAR_011443130S → Y in PKRD; Conakry. 1 PublicationCorresponds to variant dbSNP:rs118204089EnsemblClinVar.1
Natural variantiVAR_004029131Missing in PKRD. 1
Natural variantiVAR_004030134V → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs574051756Ensembl.1
Natural variantiVAR_011474153I → T in PKRD. 1
Natural variantiVAR_058470154A → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs780192373Ensembl.1
Natural variantiVAR_004031155L → P in PKRD. 1 Publication1
Natural variantiVAR_011444159G → V in PKRD. Corresponds to variant dbSNP:rs1239029841Ensembl.1
Natural variantiVAR_004033163R → C in PKRD; Linz. 1 PublicationCorresponds to variant dbSNP:rs118204083EnsemblClinVar.1
Natural variantiVAR_058471163R → L in PKRD. 1 Publication1
Natural variantiVAR_058472165G → V in PKRD. 1 Publication1
Natural variantiVAR_004032172E → Q in PKRD; Sassari. 1 PublicationCorresponds to variant dbSNP:rs757359024Ensembl.1
Natural variantiVAR_011475219I → T in PKRD. Corresponds to variant dbSNP:rs200572803Ensembl.1
Natural variantiVAR_004034221D → DD in PKRD. 1
Natural variantiVAR_011445222G → A in PKRD; Katsushika. 1
Natural variantiVAR_011447263G → R in PKRD. Corresponds to variant dbSNP:rs1253386414Ensembl.1
Natural variantiVAR_011448263G → W in PKRD. 1
Natural variantiVAR_058473272L → V in PKRD. 1 PublicationCorresponds to variant dbSNP:rs147659527Ensembl.1
Natural variantiVAR_004035275G → R in PKRD. Corresponds to variant dbSNP:rs747549978Ensembl.1
Natural variantiVAR_004036281D → N in PKRD. 1
Natural variantiVAR_004037287F → V in PKRD. 1
Natural variantiVAR_011449288V → L in PKRD; Moriguchi. 1
Natural variantiVAR_011446293D → N in PKRD. Corresponds to variant dbSNP:rs1352610988Ensembl.1
Natural variantiVAR_011450295A → V in PKRD. Corresponds to variant dbSNP:rs766353400Ensembl.1
Natural variantiVAR_011451310I → N in PKRD; Dordrecht. 1 Publication1
Natural variantiVAR_004038314I → T in PKRD; Hong Kong. Corresponds to variant dbSNP:rs981505482Ensembl.1
Natural variantiVAR_011452315E → K in PKRD. 1
Natural variantiVAR_058474320V → L in PKRD. 1 PublicationCorresponds to variant dbSNP:rs549295725Ensembl.1
Natural variantiVAR_004039331D → E in PKRD; Parma. 1 PublicationCorresponds to variant dbSNP:rs138476691Ensembl.1
Natural variantiVAR_011453331D → N in PKRD. Corresponds to variant dbSNP:rs773893686Ensembl.1
Natural variantiVAR_004040332G → S in PKRD; loss of catalytical activity. 3 PublicationsCorresponds to variant dbSNP:rs773626254EnsemblClinVar.1
Natural variantiVAR_011476335V → M in PKRD. 1 Publication1
Natural variantiVAR_004041336A → S in PKRD. 1 Publication1
Natural variantiVAR_004042337R → P in PKRD. 1 Publication1
Natural variantiVAR_004043337R → Q in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1167329263Ensembl.1
Natural variantiVAR_004044339D → H in PKRD. 1 PublicationCorresponds to variant dbSNP:rs747097960Ensembl.1
Natural variantiVAR_004045341G → A in PKRD. 2 PublicationsCorresponds to variant dbSNP:rs1227427396Ensembl.1
Natural variantiVAR_011454341G → D in PKRD. 1
Natural variantiVAR_011455342I → F in PKRD. 1
Natural variantiVAR_011456348K → N in PKRD; Kamata. 1
Natural variantiVAR_011457348Missing in PKRD; Brescia. 1 Publication1
Natural variantiVAR_011477352A → D in PKRD. Corresponds to variant dbSNP:rs1240481888Ensembl.1
Natural variantiVAR_004046354Missing in PKRD. 1 Publication1
Natural variantiVAR_004047357I → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs779152555Ensembl.1
Natural variantiVAR_058475358G → E in PKRD. 1 Publication1
Natural variantiVAR_004048359R → C in PKRD; Aomori. Corresponds to variant dbSNP:rs138871700EnsemblClinVar.1
Natural variantiVAR_004049359R → H in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1376070580Ensembl.1
Natural variantiVAR_004050361N → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs765903674EnsemblClinVar.1
Natural variantiVAR_011458364G → D in PKRD; Tjaereborg; unstability of the protein and decrease in catalytic activity. 1 PublicationCorresponds to variant dbSNP:rs981579065Ensembl.1
Natural variantiVAR_004051368V → F in PKRD; Osaka. 1 Publication1
Natural variantiVAR_058476374L → P in PKRD. 1 Publication1
Natural variantiVAR_011459376S → I in PKRD. 1
Natural variantiVAR_004052384T → M in PKRD; Tokyo/Beirut; no conformational change. 3 PublicationsCorresponds to variant dbSNP:rs74315362EnsemblClinVar.1
Natural variantiVAR_011478385R → W in PKRD. 1
Natural variantiVAR_011460387E → G in PKRD. 1 Publication1
Natural variantiVAR_011461390D → N in PKRD; Mantova; almost complete inactivation. 1 PublicationCorresponds to variant dbSNP:rs147034239Ensembl.1
Natural variantiVAR_004053392A → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1403323591Ensembl.1
Natural variantiVAR_004054393N → K in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1168490341Ensembl.1
Natural variantiVAR_004055393N → S in PKRD; Paris. 1 PublicationCorresponds to variant dbSNP:rs776594413Ensembl.1
Natural variantiVAR_011462394A → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1035640530Ensembl.1
Natural variantiVAR_011463394A → V in PKRD. 1 Publication1
Natural variantiVAR_004056401C → CS in PKRD. 1
Natural variantiVAR_011464408T → A in PKRD; Hirosaki. 1
Natural variantiVAR_004057408T → I in PKRD. 1 Publication1
Natural variantiVAR_004058421Q → K in PKRD; Fukushima/Maebashi/Sendai. 1 PublicationCorresponds to variant dbSNP:rs118204084EnsemblClinVar.1
Natural variantiVAR_004059426R → Q in PKRD; Sapporo. 1 PublicationCorresponds to variant dbSNP:rs768002493Ensembl.1
Natural variantiVAR_004060426R → W in PKRD; Naniwa. Corresponds to variant dbSNP:rs1023689443Ensembl.1
Natural variantiVAR_011465427E → A in PKRD. 1
Natural variantiVAR_011466427E → D in PKRD. 1
Natural variantiVAR_004061431A → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs762591322EnsemblClinVar.1
Natural variantiVAR_004062458G → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs755522396Ensembl.1
Natural variantiVAR_004063459A → V in PKRD. 1
Natural variantiVAR_004064460V → M in PKRD. 1 PublicationCorresponds to variant dbSNP:rs752034960EnsemblClinVar.1
Natural variantiVAR_011479468A → G in PKRD. Corresponds to variant dbSNP:rs750540943Ensembl.1
Natural variantiVAR_004065468A → V in PKRD; Hadano. 1
Natural variantiVAR_011467477T → A in PKRD. Corresponds to variant dbSNP:rs759466273Ensembl.1
Natural variantiVAR_011480479R → H in PKRD; Amish; no conformational change. 2 PublicationsCorresponds to variant dbSNP:rs118204085EnsemblClinVar.1
Natural variantiVAR_011468485S → F in PKRD. 1
Natural variantiVAR_004066486R → W in PKRD; no conformational change. 4 PublicationsCorresponds to variant dbSNP:rs116100695EnsemblClinVar.1
Natural variantiVAR_011469488R → Q in PKRD. Corresponds to variant dbSNP:rs369183199EnsemblClinVar.1
Natural variantiVAR_004067490R → W in PKRD. Corresponds to variant dbSNP:rs200133000EnsemblClinVar.1
Natural variantiVAR_011470495A → T in PKRD. 1
Natural variantiVAR_004068495A → V in PKRD. 1 PublicationCorresponds to variant dbSNP:rs141560532Ensembl.1
Natural variantiVAR_004069498R → C in PKRD. 1 PublicationCorresponds to variant dbSNP:rs551883218Ensembl.1
Natural variantiVAR_004070498R → H in PKRD. 2 PublicationsCorresponds to variant dbSNP:rs758327704Ensembl.1
Natural variantiVAR_011471504R → L in PKRD; instability of the protein. 1 PublicationCorresponds to variant dbSNP:rs185753709Ensembl.1
Natural variantiVAR_004071510R → Q in PKRD. 3 PublicationsCorresponds to variant dbSNP:rs113403872EnsemblClinVar.1
Natural variantiVAR_011472511G → R in PKRD. 1
Natural variantiVAR_011473531R → C in PKRD. 1
Natural variantiVAR_004072532R → Q in PKRD. 1 PublicationCorresponds to variant dbSNP:rs758278200Ensembl.1
Natural variantiVAR_004073532R → W in PKRD; Complete loss in the responsiveness to fructose 1,6-bisphosphate, FBP. 2 PublicationsCorresponds to variant dbSNP:rs201255024Ensembl.1
Natural variantiVAR_004074552V → M in PKRD. Corresponds to variant dbSNP:rs370316462Ensembl.1
Natural variantiVAR_011481557G → A in PKRD. 1
Natural variantiVAR_004075559R → G in PKRD. 1
Natural variantiVAR_004076566N → K in PKRD. 1
Natural variantiVAR_011482569R → Q in PKRD. 1 PublicationCorresponds to variant dbSNP:rs61755431Ensembl.1

Keywords - Diseasei

Disease variant, Hereditary hemolytic anemia

Organism-specific databases

DisGeNET

More...DisGeNETi		5313

MalaCards human disease database

More...MalaCardsi		PKLR
MIMi102900, phenotype
266200, phenotype

Open Targets

More...OpenTargetsi		ENSG00000143627

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		766, Hemolytic anemia due to red cell pyruvate kinase deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33352

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P30613, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1075126

Drug and drug target database

More...DrugBanki		DB02726, 2-Phosphoglycolic Acid
DB00787, Acyclovir
DB04551, beta-D-fructofuranose 1,6-bisphosphate
DB00119, Pyruvic acid

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PKLR

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001120941 – 574Pyruvate kinase PKLRAdd BLAST574

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2PhosphoserineCombined sources1
Modified residuei19PhosphoserineCombined sources1
Modified residuei26PhosphoserineCombined sources1
Modified residuei43PhosphoserineCombined sources1
Modified residuei292PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P30613

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P30613

MaxQB - The MaxQuant DataBase

More...MaxQBi		P30613

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P30613

PeptideAtlas

More...PeptideAtlasi		P30613

PRoteomics IDEntifications database

More...PRIDEi		P30613

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54725 [P30613-1]
54726 [P30613-2]

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		P30613

Two-dimensional polyacrylamide gel electrophoresis database from the Geneva University Hospital

More...SWISS-2DPAGEi		P30613

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P30613

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P30613

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P30613

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000143627, Expressed in liver and 139 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P30613, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P30613, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000143627, Tissue enhanced (intestine, kidney, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		111330, 26 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-3094, PKL pyruvate kinase complex [P30613-2]
CPX-3095, PKR pyruvate kinase complex [P30613-1]

Protein interaction database and analysis system

More...IntActi		P30613, 10 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000339933

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P30613

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P30613, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1574
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P30613

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P30613

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni475 – 480Fructose-1,6-bisphosphate binding; allosteric activatorCombined sources1 Publication6
Regioni559 – 564Fructose-1,6-bisphosphate binding; allosteric activatorCombined sources1 Publication6

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the pyruvate kinase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2323, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000008859

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_015439_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P30613

Identification of Orthologs from Complete Genome Data

More...OMAi		MVRVHHL

Database of Orthologous Groups

More...OrthoDBi		933620at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P30613

TreeFam database of animal gene trees

More...TreeFami		TF300390

Family and domain databases

Conserved Domains Database

More...CDDi		cd00288, Pyruvate_Kinase, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.40.33.10, 1 hit
3.20.20.60, 1 hit
3.40.1380.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001697, Pyr_Knase
IPR015813, Pyrv/PenolPyrv_Kinase-like_dom
IPR040442, Pyrv_Kinase-like_dom_sf
IPR011037, Pyrv_Knase-like_insert_dom_sf
IPR018209, Pyrv_Knase_AS
IPR015793, Pyrv_Knase_brl
IPR015795, Pyrv_Knase_C
IPR036918, Pyrv_Knase_C_sf
IPR015806, Pyrv_Knase_insert_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR11817, PTHR11817, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00224, PK, 1 hit
PF02887, PK_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01050, PYRUVTKNASE

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50800, SSF50800, 1 hit
SSF51621, SSF51621, 1 hit
SSF52935, SSF52935, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR01064, pyruv_kin, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00110, PYRUVATE_KINASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform R-type (identifier: P30613-1) [UniParc]FASTAAdd to basket
Also known as: PKR

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSIQENISSL QLRSWVSKSQ RDLAKSILIG APGGPAGYLR RASVAQLTQE 
        60         70         80         90        100
LGTAFFQQQQ LPAAMADTFL EHLCLLDIDS EPVAARSTSI IATIGPASRS 
       110        120        130        140        150
VERLKEMIKA GMNIARLNFS HGSHEYHAES IANVREAVES FAGSPLSYRP 
       160        170        180        190        200
VAIALDTKGP EIRTGILQGG PESEVELVKG SQVLVTVDPA FRTRGNANTV 
       210        220        230        240        250
WVDYPNIVRV VPVGGRIYID DGLISLVVQK IGPEGLVTQV ENGGVLGSRK 
       260        270        280        290        300
GVNLPGAQVD LPGLSEQDVR DLRFGVEHGV DIVFASFVRK ASDVAAVRAA 
       310        320        330        340        350
LGPEGHGIKI ISKIENHEGV KRFDEILEVS DGIMVARGDL GIEIPAEKVF 
       360        370        380        390        400
LAQKMMIGRC NLAGKPVVCA TQMLESMITK PRPTRAETSD VANAVLDGAD 
       410        420        430        440        450
CIMLSGETAK GNFPVEAVKM QHAIAREAEA AVYHRQLFEE LRRAAPLSRD 
       460        470        480        490        500
PTEVTAIGAV EAAFKCCAAA IIVLTTTGRS AQLLSRYRPR AAVIAVTRSA 
       510        520        530        540        550
QAARQVHLCR GVFPLLYREP PEAIWADDVD RRVQFGIESG KLRGFLRVGD 
       560        570 
LVIVVTGWRP GSGYTNIMRV LSIS
Length:574
Mass (Da):61,830
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3B430896832032F5
GO
Isoform L-type (identifier: P30613-2) [UniParc]FASTAAdd to basket
Also known as: PKL

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MSIQENISSLQLRSWVSKSQRDLAKSILIGAPG → ME

Show »
Length:543
Mass (Da):58,494
Checksum:iCA16D3984B868D9E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W6W2F8W6W2_HUMAN
Pyruvate kinase
PKLR
161Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JLC7A0A0G2JLC7_HUMAN
Pyruvate kinase PKLR
PKLR
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA02515 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti381P → A in BAA02515 (Ref. 3) Curated1
Sequence conflicti423A → R in AAA60104 (PubMed:3126495).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01143537G → E in PKHYP. 1 PublicationCorresponds to variant dbSNP:rs118204087EnsemblClinVar.1
Natural variantiVAR_05846740R → W in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1484388413Ensembl.1
Natural variantiVAR_05846848 – 53Missing in PKRD. 1 Publication6
Natural variantiVAR_05846973L → P in PKRD. 1 Publication1
Natural variantiVAR_01143680S → P in PKRD. 1
Natural variantiVAR_01143786R → P in PKRD. 1
Natural variantiVAR_01143890I → N in PKRD. 1 Publication1
Natural variantiVAR_01143995G → R in PKRD. Corresponds to variant dbSNP:rs750857114Ensembl.1
Natural variantiVAR_004028107M → T in PKRD. 1
Natural variantiVAR_011440111G → R in PKRD. 1 PublicationCorresponds to variant dbSNP:rs918627824EnsemblClinVar.1
Natural variantiVAR_011441115A → P in PKRD; Val de Marne. 1
Natural variantiVAR_011442120S → F in PKRD; Beaujon. 1
Natural variantiVAR_011443130S → Y in PKRD; Conakry. 1 PublicationCorresponds to variant dbSNP:rs118204089EnsemblClinVar.1
Natural variantiVAR_004029131Missing in PKRD. 1
Natural variantiVAR_004030134V → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs574051756Ensembl.1
Natural variantiVAR_011474153I → T in PKRD. 1
Natural variantiVAR_058470154A → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs780192373Ensembl.1
Natural variantiVAR_004031155L → P in PKRD. 1 Publication1
Natural variantiVAR_011444159G → V in PKRD. Corresponds to variant dbSNP:rs1239029841Ensembl.1
Natural variantiVAR_004033163R → C in PKRD; Linz. 1 PublicationCorresponds to variant dbSNP:rs118204083EnsemblClinVar.1
Natural variantiVAR_058471163R → L in PKRD. 1 Publication1
Natural variantiVAR_058472165G → V in PKRD. 1 Publication1
Natural variantiVAR_004032172E → Q in PKRD; Sassari. 1 PublicationCorresponds to variant dbSNP:rs757359024Ensembl.1
Natural variantiVAR_011475219I → T in PKRD. Corresponds to variant dbSNP:rs200572803Ensembl.1
Natural variantiVAR_004034221D → DD in PKRD. 1
Natural variantiVAR_011445222G → A in PKRD; Katsushika. 1
Natural variantiVAR_011447263G → R in PKRD. Corresponds to variant dbSNP:rs1253386414Ensembl.1
Natural variantiVAR_011448263G → W in PKRD. 1
Natural variantiVAR_058473272L → V in PKRD. 1 PublicationCorresponds to variant dbSNP:rs147659527Ensembl.1
Natural variantiVAR_004035275G → R in PKRD. Corresponds to variant dbSNP:rs747549978Ensembl.1
Natural variantiVAR_004036281D → N in PKRD. 1
Natural variantiVAR_004037287F → V in PKRD. 1
Natural variantiVAR_011449288V → L in PKRD; Moriguchi. 1
Natural variantiVAR_011446293D → N in PKRD. Corresponds to variant dbSNP:rs1352610988Ensembl.1
Natural variantiVAR_011450295A → V in PKRD. Corresponds to variant dbSNP:rs766353400Ensembl.1
Natural variantiVAR_011451310I → N in PKRD; Dordrecht. 1 Publication1
Natural variantiVAR_004038314I → T in PKRD; Hong Kong. Corresponds to variant dbSNP:rs981505482Ensembl.1
Natural variantiVAR_011452315E → K in PKRD. 1
Natural variantiVAR_058474320V → L in PKRD. 1 PublicationCorresponds to variant dbSNP:rs549295725Ensembl.1
Natural variantiVAR_004039331D → E in PKRD; Parma. 1 PublicationCorresponds to variant dbSNP:rs138476691Ensembl.1
Natural variantiVAR_011453331D → N in PKRD. Corresponds to variant dbSNP:rs773893686Ensembl.1
Natural variantiVAR_004040332G → S in PKRD; loss of catalytical activity. 3 PublicationsCorresponds to variant dbSNP:rs773626254EnsemblClinVar.1
Natural variantiVAR_011476335V → M in PKRD. 1 Publication1
Natural variantiVAR_004041336A → S in PKRD. 1 Publication1
Natural variantiVAR_004042337R → P in PKRD. 1 Publication1
Natural variantiVAR_004043337R → Q in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1167329263Ensembl.1
Natural variantiVAR_004044339D → H in PKRD. 1 PublicationCorresponds to variant dbSNP:rs747097960Ensembl.1
Natural variantiVAR_004045341G → A in PKRD. 2 PublicationsCorresponds to variant dbSNP:rs1227427396Ensembl.1
Natural variantiVAR_011454341G → D in PKRD. 1
Natural variantiVAR_011455342I → F in PKRD. 1
Natural variantiVAR_011456348K → N in PKRD; Kamata. 1
Natural variantiVAR_011457348Missing in PKRD; Brescia. 1 Publication1
Natural variantiVAR_011477352A → D in PKRD. Corresponds to variant dbSNP:rs1240481888Ensembl.1
Natural variantiVAR_004046354Missing in PKRD. 1 Publication1
Natural variantiVAR_004047357I → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs779152555Ensembl.1
Natural variantiVAR_058475358G → E in PKRD. 1 Publication1
Natural variantiVAR_004048359R → C in PKRD; Aomori. Corresponds to variant dbSNP:rs138871700EnsemblClinVar.1
Natural variantiVAR_004049359R → H in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1376070580Ensembl.1
Natural variantiVAR_004050361N → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs765903674EnsemblClinVar.1
Natural variantiVAR_011458364G → D in PKRD; Tjaereborg; unstability of the protein and decrease in catalytic activity. 1 PublicationCorresponds to variant dbSNP:rs981579065Ensembl.1
Natural variantiVAR_004051368V → F in PKRD; Osaka. 1 Publication1
Natural variantiVAR_058476374L → P in PKRD. 1 Publication1
Natural variantiVAR_011459376S → I in PKRD. 1
Natural variantiVAR_004052384T → M in PKRD; Tokyo/Beirut; no conformational change. 3 PublicationsCorresponds to variant dbSNP:rs74315362EnsemblClinVar.1
Natural variantiVAR_011478385R → W in PKRD. 1
Natural variantiVAR_011460387E → G in PKRD. 1 Publication1
Natural variantiVAR_011461390D → N in PKRD; Mantova; almost complete inactivation. 1 PublicationCorresponds to variant dbSNP:rs147034239Ensembl.1
Natural variantiVAR_004053392A → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1403323591Ensembl.1
Natural variantiVAR_004054393N → K in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1168490341Ensembl.1
Natural variantiVAR_004055393N → S in PKRD; Paris. 1 PublicationCorresponds to variant dbSNP:rs776594413Ensembl.1
Natural variantiVAR_011462394A → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs1035640530Ensembl.1
Natural variantiVAR_011463394A → V in PKRD. 1 Publication1
Natural variantiVAR_004056401C → CS in PKRD. 1
Natural variantiVAR_011464408T → A in PKRD; Hirosaki. 1
Natural variantiVAR_004057408T → I in PKRD. 1 Publication1
Natural variantiVAR_004058421Q → K in PKRD; Fukushima/Maebashi/Sendai. 1 PublicationCorresponds to variant dbSNP:rs118204084EnsemblClinVar.1
Natural variantiVAR_004059426R → Q in PKRD; Sapporo. 1 PublicationCorresponds to variant dbSNP:rs768002493Ensembl.1
Natural variantiVAR_004060426R → W in PKRD; Naniwa. Corresponds to variant dbSNP:rs1023689443Ensembl.1
Natural variantiVAR_011465427E → A in PKRD. 1
Natural variantiVAR_011466427E → D in PKRD. 1
Natural variantiVAR_004061431A → T in PKRD. 1 PublicationCorresponds to variant dbSNP:rs762591322EnsemblClinVar.1
Natural variantiVAR_004062458G → D in PKRD. 1 PublicationCorresponds to variant dbSNP:rs755522396Ensembl.1
Natural variantiVAR_004063459A → V in PKRD. 1
Natural variantiVAR_004064460V → M in PKRD. 1 PublicationCorresponds to variant dbSNP:rs752034960EnsemblClinVar.1
Natural variantiVAR_011479468A → G in PKRD. Corresponds to variant dbSNP:rs750540943Ensembl.1
Natural variantiVAR_004065468A → V in PKRD; Hadano. 1
Natural variantiVAR_011467477T → A in PKRD. Corresponds to variant dbSNP:rs759466273Ensembl.1
Natural variantiVAR_011480479R → H in PKRD; Amish; no conformational change. 2 PublicationsCorresponds to variant dbSNP:rs118204085EnsemblClinVar.1
Natural variantiVAR_011468485S → F in PKRD. 1
Natural variantiVAR_004066486R → W in PKRD; no conformational change. 4 PublicationsCorresponds to variant dbSNP:rs116100695EnsemblClinVar.1
Natural variantiVAR_011469488R → Q in PKRD. Corresponds to variant dbSNP:rs369183199EnsemblClinVar.1
Natural variantiVAR_004067490R → W in PKRD. Corresponds to variant dbSNP:rs200133000EnsemblClinVar.1
Natural variantiVAR_011470495A → T in PKRD. 1
Natural variantiVAR_004068495A → V in PKRD. 1 PublicationCorresponds to variant dbSNP:rs141560532Ensembl.1
Natural variantiVAR_004069498R → C in PKRD. 1 PublicationCorresponds to variant dbSNP:rs551883218Ensembl.1
Natural variantiVAR_004070498R → H in PKRD. 2 PublicationsCorresponds to variant dbSNP:rs758327704Ensembl.1
Natural variantiVAR_011471504R → L in PKRD; instability of the protein. 1 PublicationCorresponds to variant dbSNP:rs185753709Ensembl.1
Natural variantiVAR_018848506V → I1 PublicationCorresponds to variant dbSNP:rs8177988EnsemblClinVar.1
Natural variantiVAR_004071510R → Q in PKRD. 3 PublicationsCorresponds to variant dbSNP:rs113403872EnsemblClinVar.1
Natural variantiVAR_011472511G → R in PKRD. 1
Natural variantiVAR_011473531R → C in PKRD. 1
Natural variantiVAR_004072532R → Q in PKRD. 1 PublicationCorresponds to variant dbSNP:rs758278200Ensembl.1
Natural variantiVAR_004073532R → W in PKRD; Complete loss in the responsiveness to fructose 1,6-bisphosphate, FBP. 2 PublicationsCorresponds to variant dbSNP:rs201255024Ensembl.1
Natural variantiVAR_004074552V → M in PKRD. Corresponds to variant dbSNP:rs370316462Ensembl.1
Natural variantiVAR_011481557G → A in PKRD. 1
Natural variantiVAR_004075559R → G in PKRD. 1
Natural variantiVAR_004076566N → K in PKRD. 1
Natural variantiVAR_011482569R → Q in PKRD. 1 PublicationCorresponds to variant dbSNP:rs61755431Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0028831 – 33MSIQE…IGAPG → ME in isoform L-type. CuratedAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB015983 mRNA Translation: BAA31706.1
M15465 mRNA Translation: AAA60104.1
D13243 Genomic DNA Translation: BAA02515.1 Sequence problems.
AY316591 Genomic DNA Translation: AAP69527.1
BC025737 mRNA Translation: AAH25737.1
S60712 mRNA Translation: AAB26262.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1109.1 [P30613-1]
CCDS44240.1 [P30613-2]

Protein sequence database of the Protein Information Resource

More...PIRi		I52269, KIHUPR

NCBI Reference Sequences

More...RefSeqi		NP_000289.1, NM_000298.5 [P30613-1]
NP_870986.1, NM_181871.3 [P30613-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000342741; ENSP00000339933; ENSG00000143627 [P30613-1]
ENST00000392414; ENSP00000376214; ENSG00000143627 [P30613-2]
ENST00000571194; ENSP00000461487; ENSG00000262785 [P30613-2]
ENST00000572740; ENSP00000459921; ENSG00000262785 [P30613-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		5313

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:5313

UCSC genome browser

More...UCSCi		uc001fka.5, human [P30613-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Wikipedia

Pyruvate kinase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015983 mRNA Translation: BAA31706.1
M15465 mRNA Translation: AAA60104.1
D13243 Genomic DNA Translation: BAA02515.1 Sequence problems.
AY316591 Genomic DNA Translation: AAP69527.1
BC025737 mRNA Translation: AAH25737.1
S60712 mRNA Translation: AAB26262.1
CCDSiCCDS1109.1 [P30613-1]
CCDS44240.1 [P30613-2]
PIRiI52269, KIHUPR
RefSeqiNP_000289.1, NM_000298.5 [P30613-1]
NP_870986.1, NM_181871.3 [P30613-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2VGBX-ray2.73A/B/C/D47-574[»]
2VGFX-ray2.75A/B/C/D47-574[»]
2VGGX-ray2.74A/B/C/D47-574[»]
2VGIX-ray2.87A/B/C/D47-574[»]
4IMAX-ray1.95A/B/C/D34-574[»]
4IP7X-ray1.80A/B/C/D34-574[»]
6NN4X-ray2.15A/B/C/D34-574[»]
6NN5X-ray2.26A/B/C/D34-574[»]
6NN7X-ray2.32A/B/C/D/E/F/G/H34-574[»]
6NN8X-ray2.42A/B/C/D/E/F/G/H34-574[»]
SMRiP30613
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi111330, 26 interactors
ComplexPortaliCPX-3094, PKL pyruvate kinase complex [P30613-2]
CPX-3095, PKR pyruvate kinase complex [P30613-1]
IntActiP30613, 10 interactors
STRINGi9606.ENSP00000339933

Chemistry databases

BindingDBiP30613
ChEMBLiCHEMBL1075126
DrugBankiDB02726, 2-Phosphoglycolic Acid
DB00787, Acyclovir
DB04551, beta-D-fructofuranose 1,6-bisphosphate
DB00119, Pyruvic acid

PTM databases

iPTMnetiP30613
PhosphoSitePlusiP30613
SwissPalmiP30613

Genetic variation databases

BioMutaiPKLR

2D gel databases

REPRODUCTION-2DPAGEiP30613
SWISS-2DPAGEiP30613

Proteomic databases

jPOSTiP30613
MassIVEiP30613
MaxQBiP30613
PaxDbiP30613
PeptideAtlasiP30613
PRIDEiP30613
ProteomicsDBi54725 [P30613-1]
54726 [P30613-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1670, 530 antibodies

The DNASU plasmid repository

More...DNASUi		5313

Genome annotation databases

EnsembliENST00000342741; ENSP00000339933; ENSG00000143627 [P30613-1]
ENST00000392414; ENSP00000376214; ENSG00000143627 [P30613-2]
ENST00000571194; ENSP00000461487; ENSG00000262785 [P30613-2]
ENST00000572740; ENSP00000459921; ENSG00000262785 [P30613-1]
GeneIDi5313
KEGGihsa:5313
UCSCiuc001fka.5, human [P30613-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		5313
DisGeNETi5313

GeneCards: human genes, protein and diseases

More...GeneCardsi		PKLR
HGNCiHGNC:9020, PKLR
HPAiENSG00000143627, Tissue enhanced (intestine, kidney, liver)
MalaCardsiPKLR
MIMi102900, phenotype
266200, phenotype
609712, gene
neXtProtiNX_P30613
OpenTargetsiENSG00000143627
Orphaneti766, Hemolytic anemia due to red cell pyruvate kinase deficiency
PharmGKBiPA33352
VEuPathDBiHostDB:ENSG00000143627.17

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2323, Eukaryota
GeneTreeiENSGT00390000008859
HOGENOMiCLU_015439_0_1_1
InParanoidiP30613
OMAiMVRVHHL
OrthoDBi933620at2759
PhylomeDBiP30613
TreeFamiTF300390

Enzyme and pathway databases

UniPathwayiUPA00109;UER00188
BioCyciMetaCyc:HS07088-MONOMER
BRENDAi2.7.1.40, 2681
PathwayCommonsiP30613
ReactomeiR-HSA-163765, ChREBP activates metabolic gene expression [P30613-1]
R-HSA-210745, Regulation of gene expression in beta cells [P30613-2]
R-HSA-70171, Glycolysis
SABIO-RKiP30613

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		5313, 6 hits in 991 CRISPR screens
EvolutionaryTraceiP30613

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PKLR

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		5313
PharosiP30613, Tbio

Protein Ontology

More...PROi		PR:P30613
RNActiP30613, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000143627, Expressed in liver and 139 other tissues
ExpressionAtlasiP30613, baseline and differential
GenevisibleiP30613, HS

Family and domain databases

CDDicd00288, Pyruvate_Kinase, 1 hit
Gene3Di2.40.33.10, 1 hit
3.20.20.60, 1 hit
3.40.1380.20, 1 hit
InterProiView protein in InterPro
IPR001697, Pyr_Knase
IPR015813, Pyrv/PenolPyrv_Kinase-like_dom
IPR040442, Pyrv_Kinase-like_dom_sf
IPR011037, Pyrv_Knase-like_insert_dom_sf
IPR018209, Pyrv_Knase_AS
IPR015793, Pyrv_Knase_brl
IPR015795, Pyrv_Knase_C
IPR036918, Pyrv_Knase_C_sf
IPR015806, Pyrv_Knase_insert_dom_sf
PANTHERiPTHR11817, PTHR11817, 1 hit
PfamiView protein in Pfam
PF00224, PK, 1 hit
PF02887, PK_C, 1 hit
PRINTSiPR01050, PYRUVTKNASE
SUPFAMiSSF50800, SSF50800, 1 hit
SSF51621, SSF51621, 1 hit
SSF52935, SSF52935, 1 hit
TIGRFAMsiTIGR01064, pyruv_kin, 1 hit
PROSITEiView protein in PROSITE
PS00110, PYRUVATE_KINASE, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKPYR_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P30613
Secondary accession number(s): O75758, P11973
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: May 30, 2000
Last modified: June 2, 2021
This is version 238 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again