Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Prostaglandin E2 receptor EP3 subtype

Gene

Ptger3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. The various forms can interact with different second messenger systems.

GO - Molecular functioni

  • prostaglandin E receptor activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
Prostaglandin E2 receptor EP3 subtype
Short name:
PGE receptor EP3 subtype
Short name:
PGE2 receptor EP3 subtype
Alternative name(s):
Prostanoid EP3 receptor
Gene namesi
Name:Ptger3
Synonyms:Ptgerep3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:97795 Ptger3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 30ExtracellularSequence analysisAdd BLAST30
Transmembranei31 – 55Helical; Name=1Sequence analysisAdd BLAST25
Topological domaini56 – 68CytoplasmicSequence analysisAdd BLAST13
Transmembranei69 – 89Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini90 – 108ExtracellularSequence analysisAdd BLAST19
Transmembranei109 – 130Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini131 – 151CytoplasmicSequence analysisAdd BLAST21
Transmembranei152 – 173Helical; Name=4Sequence analysisAdd BLAST22
Topological domaini174 – 203ExtracellularSequence analysisAdd BLAST30
Transmembranei204 – 229Helical; Name=5Sequence analysisAdd BLAST26
Topological domaini230 – 259CytoplasmicSequence analysisAdd BLAST30
Transmembranei260 – 283Helical; Name=6Sequence analysisAdd BLAST24
Topological domaini284 – 303ExtracellularSequence analysisAdd BLAST20
Transmembranei304 – 325Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini326 – 365CytoplasmicSequence analysisAdd BLAST40

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL4336
GuidetoPHARMACOLOGYi342

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000700591 – 365Prostaglandin E2 receptor EP3 subtypeAdd BLAST365

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi16N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi107 ↔ 184PROSITE-ProRule annotation
Glycosylationi193N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

Ligand binding is affected by cAMP-dependent phosphorylation in brain membranes.

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP30557
PRIDEiP30557

PTM databases

iPTMnetiP30557
PhosphoSitePlusiP30557

Expressioni

Tissue specificityi

Kidney, uterus, and mastocytoma cells, and in a lesser amount in brain, thymus, lung, heart, stomach and spleen.

Gene expression databases

CleanExiMM_PTGER3

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000043302

Chemistry databases

BindingDBiP30557

Structurei

3D structure databases

ProteinModelPortaliP30557
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656 Eukaryota
ENOG410XRW9 LUCA
HOGENOMiHOG000015238
HOVERGENiHBG052720
InParanoidiP30557
PhylomeDBiP30557

Family and domain databases

InterProiView protein in InterPro
IPR000154 EP3_rcpt_3
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR008365 Prostanoid_rcpt
IPR001244 Prostglndn_DP_rcpt
IPR000265 Prostglndn_EP3_rcpt
PANTHERiPTHR11866 PTHR11866, 1 hit
PTHR11866:SF10 PTHR11866:SF10, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR00428 PROSTAGLNDNR
PR01788 PROSTANOIDR
PR00585 PRSTNOIDE33R
PR00582 PRSTNOIDEP3R
PROSITEiView protein in PROSITE
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist. Isoforms have identical ligand binding properties but different coupling properties with G proteins: isoform Alpha and isoform Beta couple to G(i) proteins, whereas isoform Gamma couples to multiple G proteins, G(i) and G(s). Isoform Alpha shows high agonist-independent constitutive inhibition of adenylate cyclase, while isoform Beta has no agonist independent inhibition.
Isoform Alpha (identifier: P30557-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASMWAPEHS AEAHSNLSST TDDCGSVSVA FPITMMVTGF VGNALAMLLV
60 70 80 90 100
SRSYRRRESK RKKSFLLCIG WLALTDLVGQ LLTSPVVILV YLSQRRWEQL
110 120 130 140 150
DPSGRLCTFF GLTMTVFGLS SLLVASAMAV ERALAIRAPH WYASHMKTRA
160 170 180 190 200
TPVLLGVWLS VLAFALLPVL GVGRYSVQWP GTWCFISTGP AGNETDPARE
210 220 230 240 250
PGSVAFASAF ACLGLLALVV TFACNLATIK ALVSRCRAKA AVSQSSAQWG
260 270 280 290 300
RITTETAIQL MGIMCVLSVC WSPLLIMMLK MIFNQMSVEQ CKTQMGKEKE
310 320 330 340 350
CNSFLIAVRL ASLNQILDPW VYLLLRKILL RKFCQIRDHT NYASSSTSLP
360
CPGSSALMWS DQLER
Length:365
Mass (Da):40,077
Last modified:April 1, 1993 - v1
Checksum:i1FEBEBB30C5EA67E
GO
Isoform Beta (identifier: P30557-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSALMWSDQLER → MMNNLKWTFIAVPVSLGLRISSPREG

Show »
Length:361
Mass (Da):39,684
Checksum:iFB1B5310C28320CE
GO
Isoform Gamma (identifier: P30557-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-365: IRDHTNYASSSTSLPCPGSSALMWSDQLER → VANAVSSCSSDGQKGQAISLSNEVVQPGP

Show »
Length:364
Mass (Da):39,597
Checksum:iF14BDBA15F055FD3
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001940336 – 365IRDHT…DQLER → MMNNLKWTFIAVPVSLGLRI SSPREG in isoform Beta. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_001941336 – 365IRDHT…DQLER → VANAVSSCSSDGQKGQAISL SNEVVQPGP in isoform Gamma. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D10204 mRNA Translation: BAA01051.1
D13321 mRNA Translation: BAA02578.1
D17406 mRNA Translation: BAA04229.1
PIRiA42414
A45211
S65009
UniGeneiMm.30424

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPE2R3_MOUSE
AccessioniPrimary (citable) accession number: P30557
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: June 20, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health