UniProtKB - P30520 (PURA2_HUMAN)

BLAST

>sp|P30520|PURA2_HUMAN Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS PE=1 SV=3
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF

Align
Format
Add to basket Added to basket
History
Entry version 188 (07 Nov 2018)
Sequence version 3 (27 May 2002)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Adenylosuccinate synthetase isozyme 2

Gene

ADSS

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.

Catalytic activityⁱ

GTP + IMP + L-aspartate = GDP + phosphate + N₆-(1,2-dicarboxyethyl)-AMP.UniRule annotation

Cofactorⁱ

Mg²⁺UniRule annotationNote: Binds 1 Mg²⁺ ion per subunit.UniRule annotation

Pathwayⁱ: AMP biosynthesis via de novo pathway

This protein is involved in step 1 of the subpathway that synthesizes AMP from IMP.UniRule annotation
Proteins known to be involved in the 2 steps of the subpathway in this organism are:

This subpathway is part of the pathway AMP biosynthesis via de novo pathway, which is itself part of Purine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from IMP, the pathway AMP biosynthesis via de novo pathway and in Purine metabolism.

Sites

Feature key	Position(s)	DescriptionActions	Length
Active siteⁱ	40	Proton acceptorUniRule annotation	1
Metal bindingⁱ	40	MagnesiumUniRule annotation	1
Binding siteⁱ	40	SubstrateUniRule annotation	1
Metal bindingⁱ	67	Magnesium; via carbonyl oxygenUniRule annotation	1
Active siteⁱ	68	Proton donorUniRule annotation	1
Binding siteⁱ	162	IMPUniRule annotation	1
Binding siteⁱ	176	IMP; shared with dimeric partnerUniRule annotation	1
Binding siteⁱ	255	IMPUniRule annotation	1
Binding siteⁱ	270	IMPUniRule annotation	1
Binding siteⁱ	334	IMPUniRule annotation	1
Binding siteⁱ	336	GTPUniRule annotation	1

Regions

Feature key	Position(s)	DescriptionActions	Length
Nucleotide bindingⁱ	39 – 45	GTP	7
Nucleotide bindingⁱ	67 – 69	GTP	3
Nucleotide bindingⁱ	362 – 364	GTP	3
Nucleotide bindingⁱ	444 – 447	GTP	4

GO - Molecular functionⁱ

adenylosuccinate synthase activity
Source: UniProtKB
Inferred from direct assayⁱ
- 2004783
GTP binding
Source: UniProtKB
Non-traceable author statementⁱ
- 15786719
- 1592113
magnesium ion binding Source: UniProtKB-UniRule
phosphate ion binding
Source: UniProtKB
Non-traceable author statementⁱ
- 15786719
- 1592113

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

'de novo' AMP biosynthetic process
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
AMP biosynthetic process
Source: UniProtKB
Inferred from direct assayⁱ
- 2004783
aspartate metabolic process Source: Ensembl
cellular response to electrical stimulus Source: Ensembl
immune system process
Source: UniProtKB
Non-traceable author statementⁱ
- 15786719
IMP metabolic process
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
purine ribonucleoside monophosphate biosynthetic process Source: Reactome
response to ammonium ion Source: Ensembl
response to purine-containing compound Source: Ensembl

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ligase
Biological process	Purine biosynthesis
Ligand	GTP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactomeⁱ	R-HSA-73817 Purine ribonucleoside monophosphate biosynthesis
UniPathwayⁱ	UPA00075;UER00335

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Adenylosuccinate synthetase isozyme 2UniRule annotation (EC:6.3.4.4UniRule annotation) Short name: AMPSase 2UniRule annotation Short name: AdSS 2UniRule annotation Alternative name(s): Adenylosuccinate synthetase, acidic isozymeUniRule annotation Adenylosuccinate synthetase, liver isozymeUniRule annotation Short name: L-type adenylosuccinate synthetaseUniRule annotation IMP--aspartate ligase 2UniRule annotation
Gene namesⁱ	Name:ADSSUniRule annotation Synonyms:ADSS2UniRule annotation
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000035687.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:292 ADSS
MIMⁱ	103060 gene
neXtProtⁱ	NX_P30520

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	159
Open Targets More...OpenTargetsⁱ	ENSG00000035687
PharmGKBⁱ	PA24601

Chemistry databases

ChEMBLⁱ	CHEMBL4875
Drug and drug target database More...DrugBankⁱ	DB00128 L-Aspartic Acid

Polymorphism and mutation databases

BioMutaⁱ	ADSS
DMDMⁱ	21264498

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000095130	1 – 456	Adenylosuccinate synthetase isozyme 2Add BLAST		456

Proteomic databases

EPDⁱ	P30520
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P30520
PaxDbⁱ	P30520
PeptideAtlas More...PeptideAtlasⁱ	P30520
PRIDEⁱ	P30520
ProteomicsDBⁱ	54711

PTM databases

iPTMnetⁱ	P30520
PhosphoSitePlusⁱ	P30520
SwissPalmⁱ	P30520

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000035687 Expressed in 227 organ(s), highest expression level in corpus callosum
CleanExⁱ	HS_ADSS
ExpressionAtlasⁱ	P30520 baseline and differential
Genevisibleⁱ	P30520 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA024400

HPAⁱ

HPA024400

Interactionⁱ

Subunit structureⁱ

Homodimer.UniRule annotation

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
SMYD1	Q8NB12	2	EBI-1042898,EBI-8463848

With

Entry

#Exp.

IntAct

Notes

SMYD1

Q8NB12

EBI-1042898,EBI-8463848

Protein-protein interaction databases

BioGridⁱ	106668, 46 interactors
IntActⁱ	P30520, 7 interactors
Molecular INTeraction database More...MINTⁱ	P30520
STRINGⁱ	9606.ENSP00000355493

Chemistry databases

BindingDBⁱ

P30520

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	30 – 39	Combined sources	10
Helixⁱ	43 – 51	Combined sources	9
Beta strandⁱ	55 – 59	Combined sources	5
Beta strandⁱ	68 – 72	Combined sources	5
Beta strandⁱ	75 – 82	Combined sources	8
Helixⁱ	84 – 87	Combined sources	4
Beta strandⁱ	92 – 95	Combined sources	4
Beta strandⁱ	99 – 102	Combined sources	4
Helixⁱ	103 – 116	Combined sources	14
Helixⁱ	118 – 120	Combined sources	3
Helixⁱ	123 – 125	Combined sources	3
Beta strandⁱ	126 – 130	Combined sources	5
Beta strandⁱ	134 – 136	Combined sources	3
Helixⁱ	138 – 149	Combined sources	12
Helixⁱ	166 – 174	Combined sources	9
Helixⁱ	181 – 184	Combined sources	4
Helixⁱ	188 – 205	Combined sources	18
Helixⁱ	213 – 227	Combined sources	15
Helixⁱ	228 – 230	Combined sources	3
Helixⁱ	234 – 243	Combined sources	10
Beta strandⁱ	249 – 252	Combined sources	4
Helixⁱ	257 – 259	Combined sources	3
Turnⁱ	261 – 263	Combined sources	3
Helixⁱ	277 – 283	Combined sources	7
Helixⁱ	287 – 289	Combined sources	3
Beta strandⁱ	290 – 307	Combined sources	18
Helixⁱ	316 – 324	Combined sources	9
Turnⁱ	330 – 332	Combined sources	3
Beta strandⁱ	337 – 339	Combined sources	3
Helixⁱ	343 – 353	Combined sources	11
Beta strandⁱ	356 – 361	Combined sources	6
Helixⁱ	363 – 368	Combined sources	6
Beta strandⁱ	370 – 380	Combined sources	11
Beta strandⁱ	383 – 387	Combined sources	5
Helixⁱ	392 – 395	Combined sources	4
Beta strandⁱ	399 – 406	Combined sources	8
Helixⁱ	418 – 420	Combined sources	3
Helixⁱ	423 – 436	Combined sources	14
Beta strandⁱ	440 – 444	Combined sources	5
Beta strandⁱ	446 – 448	Combined sources	3
Beta strandⁱ	451 – 454	Combined sources	4

Show more details

3D structure databases

ProteinModelPortalⁱ	P30520
SMRⁱ	P30520
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P30520

EvolutionaryTraceⁱ

P30520

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Length
Regionⁱ	40 – 43	IMP bindingUniRule annotation	4
Regionⁱ	65 – 68	IMP bindingUniRule annotation	4
Regionⁱ	330 – 336	Substrate bindingUniRule annotation	7

Sequence similaritiesⁱ

Belongs to the adenylosuccinate synthetase family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	KOG1355 Eukaryota COG0104 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000015553
HOGENOMⁱ	HOG000260959
HOVERGENⁱ	HBG053768
InParanoidⁱ	P30520
KEGG Orthology (KO) More...KOⁱ	K01939
OMAⁱ	GIAPFYS
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G1BIK
PhylomeDBⁱ	P30520
TreeFamⁱ	TF300486

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd03108 AdSS, 1 hit
HAMAPⁱ	MF_00011 Adenylosucc_synth, 1 hit MF_03127 Adenylosucc_synth_vert_acid, 1 hit
InterProⁱ	View protein in InterPro IPR018220 Adenylosuccin_syn_GTP-bd IPR033128 Adenylosuccin_syn_Lys_AS IPR001114 Adenylosuccinate_synthetase IPR027529 AdSS_2_vert IPR027417 P-loop_NTPase
PANTHERⁱ	PTHR11846 PTHR11846, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00709 Adenylsucc_synt, 1 hit
SMARTⁱ	View protein in SMART SM00788 Adenylsucc_synt, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR00184 purA, 1 hit
PROSITEⁱ	View protein in PROSITE PS01266 ADENYLOSUCCIN_SYN_1, 1 hit PS00513 ADENYLOSUCCIN_SYN_2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P30520-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAFAETYPAA SSLPNGDCGR PRARPGGNRV TVVLGAQWGD EGKGKVVDLL 
        60         70         80         90        100
AQDADIVCRC QGGNNAGHTV VVDSVEYDFH LLPSGIINPN VTAFIGNGVV 
       110        120        130        140        150
IHLPGLFEEA EKNVQKGKGL EGWEKRLIIS DRAHIVFDFH QAADGIQEQQ 
       160        170        180        190        200
RQEQAGKNLG TTKKGIGPVY SSKAARSGLR MCDLVSDFDG FSERFKVLAN 
       210        220        230        240        250
QYKSIYPTLE IDIEGELQKL KGYMEKIKPM VRDGVYFLYE ALHGPPKKIL 
       260        270        280        290        300
VEGANAALLD IDFGTYPFVT SSNCTVGGVC TGLGMPPQNV GEVYGVVKAY 
       310        320        330        340        350
TTRVGIGAFP TEQDNEIGEL LQTRGREFGV TTGRKRRCGW LDLVLLKYAH 
       360        370        380        390        400
MINGFTALAL TKLDILDMFT EIKVGVAYKL DGEIIPHIPA NQEVLNKVEV 
       410        420        430        440        450
QYKTLPGWNT DISNARAFKE LPVNAQNYVR FIEDELQIPV KWIGVGKSRE 

SMIQLF

Length:456

Mass (Da):50,097

Last modified:May 27, 2002 - v3

Checksum:ⁱ23B7AAC58A238783

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	24 – 25	RP → A in CAA47123 (PubMed:1592113).Curated		2

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_051881	179	L → F. Corresponds to variant dbSNP:rs12134870Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X66503 Genomic DNA Translation: CAA47123.1 AL591594 Genomic DNA No translation available. AL645465 Genomic DNA No translation available. CH471148 Genomic DNA Translation: EAW77102.1 BC012356 mRNA Translation: AAH12356.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS1624.1
PIRⁱ	S21166
NCBI Reference Sequences More...RefSeqⁱ	NP_001117.2, NM_001126.3
UniGeneⁱ	Hs.498313

Genome annotation databases

Ensemblⁱ	ENST00000366535; ENSP00000355493; ENSG00000035687
GeneIDⁱ	159
KEGGⁱ	hsa:159
UCSC genome browser More...UCSCⁱ	uc001iaj.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P30520	Adenylosuccinate synthetase isozyme 2		HUMAN		456	UniRef100_P30520

Protein	Similar proteins		Species	Score	Length	Source
P30520	Adenylosuccinate synthetase isozyme 2		PIG		456	UniRef90_P30520
Adenylosuccinate synthetase isozyme 2		MOUSE		456
Adenylosuccinate synthetase isozyme 2		BOVIN		456
Adenylosuccinate synthetase isozyme 2		HUMAN		456
Adenylosuccinate synthetase isozyme 2		HETGA		484
+135

Protein	Similar proteins		Species	Score	Length	Source
P30520	Adenylosuccinate synthetase isozyme 1	)	MOUSE		457	UniRef50_P28650
Adenylosuccinate synthetase isozyme 1		BOVIN		457
Adenylosuccinate synthetase isozyme 1		PIG		457
Adenylosuccinate synthetase isozyme 1	)	HUMAN		457
Adenylosuccinate synthetase		MALGO		445
+1109

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X66503 Genomic DNA Translation: CAA47123.1 AL591594 Genomic DNA No translation available. AL645465 Genomic DNA No translation available. CH471148 Genomic DNA Translation: EAW77102.1 BC012356 mRNA Translation: AAH12356.1
CCDSⁱ	CCDS1624.1
PIRⁱ	S21166
RefSeqⁱ	NP_001117.2, NM_001126.3
UniGeneⁱ	Hs.498313

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2V40	X-ray	1.90	A	21-456	[»]
ProteinModelPortalⁱ	P30520
SMRⁱ	P30520
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	106668, 46 interactors
IntActⁱ	P30520, 7 interactors
MINTⁱ	P30520
STRINGⁱ	9606.ENSP00000355493

Chemistry databases

BindingDBⁱ	P30520
ChEMBLⁱ	CHEMBL4875
DrugBankⁱ	DB00128 L-Aspartic Acid

PTM databases

iPTMnetⁱ	P30520
PhosphoSitePlusⁱ	P30520
SwissPalmⁱ	P30520

Polymorphism and mutation databases

BioMutaⁱ	ADSS
DMDMⁱ	21264498

Proteomic databases

EPDⁱ	P30520
MaxQBⁱ	P30520
PaxDbⁱ	P30520
PeptideAtlasⁱ	P30520
PRIDEⁱ	P30520
ProteomicsDBⁱ	54711

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	159
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000366535; ENSP00000355493; ENSG00000035687
GeneIDⁱ	159
KEGGⁱ	hsa:159
UCSCⁱ	uc001iaj.4 human

Organism-specific databases

CTDⁱ	159
DisGeNETⁱ	159
EuPathDBⁱ	HostDB:ENSG00000035687.9
GeneCardsⁱ	ADSS
HGNCⁱ	HGNC:292 ADSS
HPAⁱ	HPA024400
MIMⁱ	103060 gene
neXtProtⁱ	NX_P30520
OpenTargetsⁱ	ENSG00000035687
PharmGKBⁱ	PA24601
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1355 Eukaryota COG0104 LUCA
GeneTreeⁱ	ENSGT00390000015553
HOGENOMⁱ	HOG000260959
HOVERGENⁱ	HBG053768
InParanoidⁱ	P30520
KOⁱ	K01939
OMAⁱ	GIAPFYS
OrthoDBⁱ	EOG091G1BIK
PhylomeDBⁱ	P30520
TreeFamⁱ	TF300486

Enzyme and pathway databases

UniPathwayⁱ	UPA00075;UER00335
Reactomeⁱ	R-HSA-73817 Purine ribonucleoside monophosphate biosynthesis

Miscellaneous databases

ChiTaRSⁱ	ADSS human
EvolutionaryTraceⁱ	P30520
GenomeRNAiⁱ	159
Protein Ontology More...PROⁱ	PR:P30520
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000035687 Expressed in 227 organ(s), highest expression level in corpus callosum
CleanExⁱ	HS_ADSS
ExpressionAtlasⁱ	P30520 baseline and differential
Genevisibleⁱ	P30520 HS

Family and domain databases

CDDⁱ	cd03108 AdSS, 1 hit
HAMAPⁱ	MF_00011 Adenylosucc_synth, 1 hit MF_03127 Adenylosucc_synth_vert_acid, 1 hit
InterProⁱ	View protein in InterPro IPR018220 Adenylosuccin_syn_GTP-bd IPR033128 Adenylosuccin_syn_Lys_AS IPR001114 Adenylosuccinate_synthetase IPR027529 AdSS_2_vert IPR027417 P-loop_NTPase
PANTHERⁱ	PTHR11846 PTHR11846, 1 hit
Pfamⁱ	View protein in Pfam PF00709 Adenylsucc_synt, 1 hit
SMARTⁱ	View protein in SMART SM00788 Adenylsucc_synt, 1 hit
SUPFAMⁱ	SSF52540 SSF52540, 1 hit
TIGRFAMsⁱ	TIGR00184 purA, 1 hit
PROSITEⁱ	View protein in PROSITE PS01266 ADENYLOSUCCIN_SYN_1, 1 hit PS00513 ADENYLOSUCCIN_SYN_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PURA2_HUMAN
Accessionⁱ	P30520Primary (citable) accession number: P30520 Secondary accession number(s): B1AQM5, Q96EG7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	April 1, 1993
	Last sequence update:	May 27, 2002
	Last modified:	November 7, 2018
	This is version 188 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PATHWAY comments
Index of metabolic and biosynthesis pathways
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P30520 (PURA2_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Adenylosuccinate synthetase isozyme 2

ADSS

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: AMP biosynthesis via de novo pathway

Sites

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Cytosol

Extracellular region or secreted

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Pathwayⁱ: AMP biosynthesis via de novo pathway

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ