Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 195 (08 May 2019)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

M-phase inducer phosphatase 3

Gene

CDC25C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei377By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processCell cycle, Cell division, Host-virus interaction, Mitosis

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.48 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-156711 Polo-like kinase mediated events
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-5625740 RHO GTPases activate PKNs
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-75035 Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
R-HSA-8862803 Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P30307

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
M-phase inducer phosphatase 3 (EC:3.1.3.48)
Alternative name(s):
Dual specificity phosphatase Cdc25C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDC25C
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1727 CDC25C

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
157680 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P30307

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi129S → V: Loss of phosphorylation. Severely impairs PLK1-binding. 1 Publication1
Mutagenesisi130T → A: Loss of phosphorylation. Severely impairs PLK1-binding. 1 Publication1
Mutagenesisi191S → A: Facilitates nuclear exclusion. 1 Publication1
Mutagenesisi191S → D: Mimicks phosphorylation state, leading to enhanced accumulation in the nucleus. 1 Publication1
Mutagenesisi352E → K: Partial loss of HIV-1 Vpr binding. 1 Publication1
Mutagenesisi359K → E: No effect on HIV-1 Vpr binding. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
995

Open Targets

More...
OpenTargetsi
ENSG00000158402

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA100

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2378

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDC25C

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242631

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001986472 – 473M-phase inducer phosphatase 3Add BLAST472

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei20PhosphoserineCombined sources1
Modified residuei38PhosphoserineCombined sources1
Modified residuei48PhosphothreonineCombined sources1 Publication1
Modified residuei57PhosphoserineCombined sources1
Modified residuei61PhosphoserineCombined sources1
Modified residuei64PhosphoserineCombined sources1
Modified residuei67PhosphothreonineCombined sources1 Publication1
Modified residuei122Phosphoserine; by CDK11 Publication1
Modified residuei129Phosphoserine1 Publication1
Modified residuei130Phosphothreonine1 Publication1
Modified residuei168PhosphoserineCombined sources1 Publication1
Modified residuei191Phosphoserine; by PLK31 Publication1
Modified residuei198Phosphoserine; by PLK31 Publication1
Modified residuei214Phosphoserine; by CDK11 Publication1
Modified residuei216Phosphoserine; by CHEK1, CHEK2, BRSK1 and MAPK14Combined sources3 Publications1
Modified residuei472PhosphoserineCombined sources1
Isoform 4 (identifier: P30307-3)
Modified residuei61Phosphoserine1
Isoform 5 (identifier: P30307-4)
Modified residuei61Phosphoserine1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CHEK1 and MAPK14 at Ser-216. This phosphorylation creates a binding site for 14-3-3 protein and inhibits the phosphatase. Phosphorylated by PLK4. Phosphorylated by PLK1, leading to activate the phosphatase activity. Phosphorylation by PLK3 at Ser-191 promotes nuclear translocation. Ser-198 is a minor phosphorylation site. Was initially reported to be phosphorylated by PLK3 at Ser-216 (PubMed:10557092). However, such phosphorylation by PLK3 was not confirmed by other groups. Phosphorylation at Thr-48, Thr-67, Ser-122, Thr-130, Ser-168 and Ser-214 occurs at G2 and G2-M transition and is probably catalyzed by CDK1. Ser-168 phosphorylation levels are lower than those at the other 5 CDK1 sites. Phosphorylation by CDK1 leads to increased activity.8 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P30307

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P30307

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P30307

PeptideAtlas

More...
PeptideAtlasi
P30307

PRoteomics IDEntifications database

More...
PRIDEi
P30307

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54658
54659 [P30307-2]
54660 [P30307-3]
54661 [P30307-4]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
P30307

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P30307

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P30307

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed predominantly in G2 phase.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000158402 Expressed in 92 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P30307 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P30307 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB003800
HPA066991

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAPK14 and 14-3-3 proteins. When phosphorylated on Ser-129 and/or Thr-130, interacts with PLK1.

2 Publications

(Microbial infection)

Interacts with HIV-1 Vpr; this interaction inactivates CDC25C phosphatase activity.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107430, 107 interactors

Database of interacting proteins

More...
DIPi
DIP-24183N

Protein interaction database and analysis system

More...
IntActi
P30307, 18 interactors

Molecular INTeraction database

More...
MINTi
P30307

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000321656

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P30307

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1473
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P30307

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P30307

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini321 – 428RhodanesePROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni334 – 379HIV-1 Vpr binding siteAdd BLAST46

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MPI phosphatase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3772 Eukaryota
COG5105 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161460

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P30307

KEGG Orthology (KO)

More...
KOi
K05867

Identification of Orthologs from Complete Genome Data

More...
OMAi
SKAWEGE

Database of Orthologous Groups

More...
OrthoDBi
1423329at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P30307

TreeFam database of animal gene trees

More...
TreeFami
TF101056

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01530 Cdc25, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.250.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000751 MPI_Phosphatase
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06617 M-inducer_phosp, 1 hit
PF00581 Rhodanese, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00716 MPIPHPHTASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00450 RHOD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52821 SSF52821, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50206 RHODANESE_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P30307-1) [UniParc]FASTAAdd to basket
Also known as: CDC25C1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTELFSSTR EEGSSGSGPS FRSNQRKMLN LLLERDTSFT VCPDVPRTPV
60 70 80 90 100
GKFLGDSANL SILSGGTPKR CLDLSNLSSG EITATQLTTS ADLDETGHLD
110 120 130 140 150
SSGLQEVHLA GMNHDQHLMK CSPAQLLCST PNGLDRGHRK RDAMCSSSAN
160 170 180 190 200
KENDNGNLVD SEMKYLGSPI TTVPKLDKNP NLGEDQAEEI SDELMEFSLK
210 220 230 240 250
DQEAKVSRSG LYRSPSMPEN LNRPRLKQVE KFKDNTIPDK VKKKYFSGQG
260 270 280 290 300
KLRKGLCLKK TVSLCDITIT QMLEEDSNQG HLIGDFSKVC ALPTVSGKHQ
310 320 330 340 350
DLKYVNPETV AALLSGKFQG LIEKFYVIDC RYPYEYLGGH IQGALNLYSQ
360 370 380 390 400
EELFNFFLKK PIVPLDTQKR IIIVFHCEFS SERGPRMCRC LREEDRSLNQ
410 420 430 440 450
YPALYYPELY ILKGGYRDFF PEYMELCEPQ SYCPMHHQDH KTELLRCRSQ
460 470
SKVQEGERQL REQIALLVKD MSP
Length:473
Mass (Da):53,365
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0658A1F1B9B8996A
GO
Isoform 2 (identifier: P30307-2) [UniParc]FASTAAdd to basket
Also known as: CDC25C2

The sequence of this isoform differs from the canonical sequence as follows:
     124-153: Missing.

Show »
Length:443
Mass (Da):50,122
Checksum:i11480DF49B3F04DD
GO
Isoform 3 (identifier: P30307-5)
Also known as: CDC25C3
Sequence is not available
Length:
Mass (Da):
Isoform 4 (identifier: P30307-3) [UniParc]FASTAAdd to basket
Also known as: CDC25C4

The sequence of this isoform differs from the canonical sequence as follows:
     66-123: GTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSP → SPGFFRTSGSAFSWD

Show »
Length:430
Mass (Da):48,851
Checksum:iF2DDF9DB1653BCEE
GO
Isoform 5 (identifier: P30307-4) [UniParc]FASTAAdd to basket
Also known as: CDC25C5, Cdc25Cdm

The sequence of this isoform differs from the canonical sequence as follows:
     66-123: GTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSP → SPGFFRTSGSAFSWD
     124-153: Missing.

Show »
Length:400
Mass (Da):45,608
Checksum:i212EA5FD75672289
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RJC2D6RJC2_HUMAN
M-phase inducer phosphatase 3
CDC25C
249Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD20D6RD20_HUMAN
M-phase inducer phosphatase 3
CDC25C
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y999H0Y999_HUMAN
M-phase inducer phosphatase 3
CDC25C
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IT42A0A3B3IT42_HUMAN
M-phase inducer phosphatase 3
CDC25C
232Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02792214S → N. Corresponds to variant dbSNP:rs11567959Ensembl.1
Natural variantiVAR_02792370R → C3 PublicationsCorresponds to variant dbSNP:rs3734166Ensembl.1
Natural variantiVAR_02792478S → N. Corresponds to variant dbSNP:rs11567962Ensembl.1
Natural variantiVAR_020146297G → R. Corresponds to variant dbSNP:rs11567997Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00086366 – 123GTPKR…MKCSP → SPGFFRTSGSAFSWD in isoform 4 and isoform 5. 2 PublicationsAdd BLAST58
Alternative sequenceiVSP_000864124 – 153Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M34065 mRNA Translation: AAA35666.1
AJ304504 mRNA Translation: CAC19192.1
AY497474 Genomic DNA Translation: AAR32098.1
CH471062 Genomic DNA Translation: EAW62145.1
CH471062 Genomic DNA Translation: EAW62149.1
BC019089 mRNA Translation: AAH19089.1
AF277723 mRNA Translation: AAG41885.1
AF277725 mRNA Translation: AAG41887.1
AF277726 mRNA Translation: AAG41888.1
AF312681 mRNA Translation: AAL26835.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4202.1 [P30307-1]
CCDS4203.1 [P30307-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
I59168 A38874

NCBI Reference Sequences

More...
RefSeqi
NP_001274511.1, NM_001287582.1 [P30307-1]
NP_001305027.1, NM_001318098.1
NP_001781.2, NM_001790.4 [P30307-1]
NP_073720.1, NM_022809.3 [P30307-4]
XP_011542064.1, XM_011543762.1 [P30307-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000323760; ENSP00000321656; ENSG00000158402 [P30307-1]
ENST00000348983; ENSP00000345205; ENSG00000158402 [P30307-4]
ENST00000415130; ENSP00000392631; ENSG00000158402 [P30307-4]
ENST00000513970; ENSP00000424795; ENSG00000158402 [P30307-1]
ENST00000514555; ENSP00000425470; ENSG00000158402 [P30307-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
995

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:995

UCSC genome browser

More...
UCSCi
uc003lcp.3 human [P30307-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M34065 mRNA Translation: AAA35666.1
AJ304504 mRNA Translation: CAC19192.1
AY497474 Genomic DNA Translation: AAR32098.1
CH471062 Genomic DNA Translation: EAW62145.1
CH471062 Genomic DNA Translation: EAW62149.1
BC019089 mRNA Translation: AAH19089.1
AF277723 mRNA Translation: AAG41885.1
AF277725 mRNA Translation: AAG41887.1
AF277726 mRNA Translation: AAG41888.1
AF312681 mRNA Translation: AAL26835.1
CCDSiCCDS4202.1 [P30307-1]
CCDS4203.1 [P30307-4]
PIRiI59168 A38874
RefSeqiNP_001274511.1, NM_001287582.1 [P30307-1]
NP_001305027.1, NM_001318098.1
NP_001781.2, NM_001790.4 [P30307-1]
NP_073720.1, NM_022809.3 [P30307-4]
XP_011542064.1, XM_011543762.1 [P30307-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OJXX-ray2.85E126-134[»]
3BZIX-ray2.10E126-134[»]
3OP3X-ray2.63A270-462[»]
5M35X-ray2.38C/D207-244[»]
5M36X-ray2.45C/D207-244[»]
5M37X-ray2.35C/D207-226[»]
SMRiP30307
ModBaseiSearch...

Protein-protein interaction databases

BioGridi107430, 107 interactors
DIPiDIP-24183N
IntActiP30307, 18 interactors
MINTiP30307
STRINGi9606.ENSP00000321656

Chemistry databases

BindingDBiP30307
ChEMBLiCHEMBL2378

PTM databases

DEPODiP30307
iPTMnetiP30307
PhosphoSitePlusiP30307

Polymorphism and mutation databases

BioMutaiCDC25C
DMDMi116242631

Proteomic databases

EPDiP30307
jPOSTiP30307
PaxDbiP30307
PeptideAtlasiP30307
PRIDEiP30307
ProteomicsDBi54658
54659 [P30307-2]
54660 [P30307-3]
54661 [P30307-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
995
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000323760; ENSP00000321656; ENSG00000158402 [P30307-1]
ENST00000348983; ENSP00000345205; ENSG00000158402 [P30307-4]
ENST00000415130; ENSP00000392631; ENSG00000158402 [P30307-4]
ENST00000513970; ENSP00000424795; ENSG00000158402 [P30307-1]
ENST00000514555; ENSP00000425470; ENSG00000158402 [P30307-2]
GeneIDi995
KEGGihsa:995
UCSCiuc003lcp.3 human [P30307-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
995
DisGeNETi995

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDC25C
HGNCiHGNC:1727 CDC25C
HPAiCAB003800
HPA066991
MIMi157680 gene
neXtProtiNX_P30307
OpenTargetsiENSG00000158402
PharmGKBiPA100

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3772 Eukaryota
COG5105 LUCA
GeneTreeiENSGT00940000161460
InParanoidiP30307
KOiK05867
OMAiSKAWEGE
OrthoDBi1423329at2759
PhylomeDBiP30307
TreeFamiTF101056

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
ReactomeiR-HSA-156711 Polo-like kinase mediated events
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-5625740 RHO GTPases activate PKNs
R-HSA-6804114 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
R-HSA-6804115 TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-75035 Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex
R-HSA-8862803 Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
SIGNORiP30307

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDC25C human
EvolutionaryTraceiP30307

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CDC25C

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
995

Protein Ontology

More...
PROi
PR:P30307

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000158402 Expressed in 92 organ(s), highest expression level in testis
ExpressionAtlasiP30307 baseline and differential
GenevisibleiP30307 HS

Family and domain databases

CDDicd01530 Cdc25, 1 hit
Gene3Di3.40.250.10, 1 hit
InterProiView protein in InterPro
IPR000751 MPI_Phosphatase
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf
PfamiView protein in Pfam
PF06617 M-inducer_phosp, 1 hit
PF00581 Rhodanese, 1 hit
PRINTSiPR00716 MPIPHPHTASE
SMARTiView protein in SMART
SM00450 RHOD, 1 hit
SUPFAMiSSF52821 SSF52821, 1 hit
PROSITEiView protein in PROSITE
PS50206 RHODANESE_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPIP3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P30307
Secondary accession number(s): D3DQB8
, Q96PL3, Q9H168, Q9H2E8, Q9H2E9, Q9H2F1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 17, 2006
Last modified: May 8, 2019
This is version 195 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again