Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

M-phase inducer phosphatase 2

Gene

CDC25B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Directly dephosphorylates CDK1 and stimulates its kinase activity. The three isoforms seem to have a different level of activity.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Activity regulationi

Stimulated by B-type cyclins.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei4871

GO - Molecular functioni

  • phosphoprotein phosphatase activity Source: Reactome
  • protein kinase binding Source: UniProtKB
  • protein tyrosine phosphatase activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
ReactomeiR-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8862803 Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
SIGNORiP30305

Names & Taxonomyi

Protein namesi
Recommended name:
M-phase inducer phosphatase 2 (EC:3.1.3.48)
Alternative name(s):
Dual specificity phosphatase Cdc25B
Gene namesi
Name:CDC25B
Synonyms:CDC25HU2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000101224.17
HGNCiHGNC:1726 CDC25B
MIMi116949 gene
neXtProtiNX_P30305

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi994
OpenTargetsiENSG00000101224
PharmGKBiPA26260

Chemistry databases

ChEMBLiCHEMBL4804
DrugBankiDB03661 Cysteinesulfonic Acid

Polymorphism and mutation databases

DMDMi21264471

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001986441 – 580M-phase inducer phosphatase 2Add BLAST580

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei42PhosphoserineBy similarity1
Modified residuei169Phosphoserine; by MELK1 Publication1
Modified residuei249PhosphoserineCombined sources1
Modified residuei323Phosphoserine; by MELK and MAPK14Combined sources3 Publications1
Modified residuei353Phosphoserine; by AURKACombined sources1 Publication1
Modified residuei375Phosphoserine; by BRSK1 and MAPK14Combined sources2 Publications1
Modified residuei470PhosphoserineCombined sources1
Modified residuei563PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by BRSK1 in vitro. Phosphorylated by CHEK1, which inhibits the activity of this protein. Phosphorylation at Ser-353 by AURKA might locally participate in the control of the onset of mitosis. Phosphorylation by MELK at Ser-169 promotes localization to the centrosome and the spindle poles during mitosis. Phosphorylation at Ser-323 and Ser-375 by MAPK14 is required for binding to 14-3-3 proteins.8 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP30305
MaxQBiP30305
PaxDbiP30305
PeptideAtlasiP30305
PRIDEiP30305
ProteomicsDBi54654
54655 [P30305-2]
54656 [P30305-3]
54657 [P30305-4]

PTM databases

DEPODiP30305
iPTMnetiP30305
PhosphoSitePlusiP30305

Expressioni

Gene expression databases

BgeeiENSG00000101224 Expressed in 220 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_CDC25B
ExpressionAtlasiP30305 baseline and differential
GenevisibleiP30305 HS

Organism-specific databases

HPAiHPA038892
HPA038893
HPA075215

Interactioni

Subunit structurei

Interacts with MAPK14 and 14-3-3 proteins.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107429, 100 interactors
DIPiDIP-323N
ELMiP30305
IntActiP30305, 16 interactors
MINTiP30305
STRINGi9606.ENSP00000245960

Chemistry databases

BindingDBiP30305

Structurei

Secondary structure

1580
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP30305
SMRiP30305
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP30305

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini431 – 538RhodanesePROSITE-ProRule annotationAdd BLAST108

Sequence similaritiesi

Belongs to the MPI phosphatase family.Curated

Phylogenomic databases

eggNOGiKOG3772 Eukaryota
COG5105 LUCA
GeneTreeiENSGT00390000018747
HOVERGENiHBG052501
InParanoidiP30305
KOiK05866
OMAiNEQFSIR
OrthoDBiEOG091G0H0D
PhylomeDBiP30305
TreeFamiTF101056

Family and domain databases

CDDicd01530 Cdc25, 1 hit
Gene3Di3.40.250.10, 1 hit
InterProiView protein in InterPro
IPR000751 MPI_Phosphatase
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf
PfamiView protein in Pfam
PF06617 M-inducer_phosp, 1 hit
PF00581 Rhodanese, 1 hit
PRINTSiPR00716 MPIPHPHTASE
SMARTiView protein in SMART
SM00450 RHOD, 1 hit
SUPFAMiSSF52821 SSF52821, 1 hit
PROSITEiView protein in PROSITE
PS50206 RHODANESE_3, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: P30305-1) [UniParc]FASTAAdd to basket
Also known as: CDC25B3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVPQPEPAP GSALSPAGVC GGAQRPGHLP GLLLGSHGLL GSPVRAAASS
60 70 80 90 100
PVTTLTQTMH DLAGLGSETP KSQVGTLLFR SRSRLTHLSL SRRASESSLS
110 120 130 140 150
SESSESSDAG LCMDSPSPMD PHMAEQTFEQ AIQAASRIIR NEQFAIRRFQ
160 170 180 190 200
SMPVRLLGHS PVLRNITNSQ APDGRRKSEA GSGAASSSGE DKENDGFVFK
210 220 230 240 250
MPWKPTHPSS THALAEWASR REAFAQRPSS APDLMCLSPD RKMEVEELSP
260 270 280 290 300
LALGRFSLTP AEGDTEEDDG FVDILESDLK DDDAVPPGME SLISAPLVKT
310 320 330 340 350
LEKEEEKDLV MYSKCQRLFR SPSMPCSVIR PILKRLERPQ DRDTPVQNKR
360 370 380 390 400
RRSVTPPEEQ QEAEEPKARV LRSKSLCHDE IENLLDSDHR ELIGDYSKAF
410 420 430 440 450
LLQTVDGKHQ DLKYISPETM VALLTGKFSN IVDKFVIVDC RYPYEYEGGH
460 470 480 490 500
IKTAVNLPLE RDAESFLLKS PIAPCSLDKR VILIFHCEFS SERGPRMCRF
510 520 530 540 550
IRERDRAVND YPSLYYPEMY ILKGGYKEFF PQHPNFCEPQ DYRPMNHEAF
560 570 580
KDELKTFRLK TRSWAGERSR RELCSRLQDQ
Length:580
Mass (Da):64,987
Last modified:May 27, 2002 - v2
Checksum:iEDE24B0E84AC1BE3
GO
Isoform 1 (identifier: P30305-2) [UniParc]FASTAAdd to basket
Also known as: CDC25B1

The sequence of this isoform differs from the canonical sequence as follows:
     68-81: Missing.

Show »
Length:566
Mass (Da):63,443
Checksum:i7C54E3E799ECDA50
GO
Isoform 2 (identifier: P30305-3) [UniParc]FASTAAdd to basket
Also known as: CDC25B2

The sequence of this isoform differs from the canonical sequence as follows:
     154-194: Missing.

Show »
Length:539
Mass (Da):60,756
Checksum:iCDA92929F8183BE9
GO
Isoform 4 (identifier: P30305-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-81: Missing.
     194-194: N → NVRFWKAGVGALREEEGACWGGSLACEDPPLPSWLQ

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):67,241
Checksum:i8E32AEC15A3845D7
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G8JLH2G8JLH2_HUMAN
M-phase inducer phosphatase 2
CDC25B
489Annotation score:
B4DIG0B4DIG0_HUMAN
M-phase inducer phosphatase 2
CDC25B
516Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti575S → D in AAB21139 (PubMed:1662986).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_020933548E → K1 PublicationCorresponds to variant dbSNP:rs11570019Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00086168 – 81Missing in isoform 1 and isoform 4. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_000862154 – 194Missing in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_012587194N → NVRFWKAGVGALREEEGACW GGSLACEDPPLPSWLQ in isoform 4. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M81934 mRNA Translation: AAA58416.1
S78187 mRNA Translation: AAB21139.1
X96436 Genomic DNA Translation: CAA65303.1
Z68092 mRNA Translation: CAA92108.1
AY494082 Genomic DNA Translation: AAR26469.1
AL109804 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10491.1
CH471133 Genomic DNA Translation: EAX10492.1
CH471133 Genomic DNA Translation: EAX10493.1
CH471133 Genomic DNA Translation: EAX10494.1
CH471133 Genomic DNA Translation: EAX10496.1
CH471133 Genomic DNA Translation: EAX10497.1
CH471133 Genomic DNA Translation: EAX10498.1
CH471133 Genomic DNA Translation: EAX10499.1
BC006395 mRNA Translation: AAH06395.1
BC009953 mRNA Translation: AAH09953.1
BC051711 mRNA Translation: AAH51711.1
AF036233 Genomic DNA Translation: AAB94622.1
AF036233 Genomic DNA Translation: AAB94624.1
CCDSiCCDS13065.1 [P30305-2]
CCDS13066.1 [P30305-3]
CCDS13067.1 [P30305-1]
PIRiB41648
RefSeqiNP_001274448.1, NM_001287519.1
NP_001274453.1, NM_001287524.1
NP_004349.1, NM_004358.4 [P30305-2]
NP_068658.1, NM_021872.3 [P30305-3]
NP_068659.1, NM_021873.3 [P30305-1]
UniGeneiHs.153752

Genome annotation databases

EnsembliENST00000245960; ENSP00000245960; ENSG00000101224 [P30305-1]
ENST00000340833; ENSP00000339170; ENSG00000101224 [P30305-3]
ENST00000439880; ENSP00000405972; ENSG00000101224 [P30305-2]
GeneIDi994
KEGGihsa:994
UCSCiuc002wjn.5 human [P30305-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M81934 mRNA Translation: AAA58416.1
S78187 mRNA Translation: AAB21139.1
X96436 Genomic DNA Translation: CAA65303.1
Z68092 mRNA Translation: CAA92108.1
AY494082 Genomic DNA Translation: AAR26469.1
AL109804 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10491.1
CH471133 Genomic DNA Translation: EAX10492.1
CH471133 Genomic DNA Translation: EAX10493.1
CH471133 Genomic DNA Translation: EAX10494.1
CH471133 Genomic DNA Translation: EAX10496.1
CH471133 Genomic DNA Translation: EAX10497.1
CH471133 Genomic DNA Translation: EAX10498.1
CH471133 Genomic DNA Translation: EAX10499.1
BC006395 mRNA Translation: AAH06395.1
BC009953 mRNA Translation: AAH09953.1
BC051711 mRNA Translation: AAH51711.1
AF036233 Genomic DNA Translation: AAB94622.1
AF036233 Genomic DNA Translation: AAB94624.1
CCDSiCCDS13065.1 [P30305-2]
CCDS13066.1 [P30305-3]
CCDS13067.1 [P30305-1]
PIRiB41648
RefSeqiNP_001274448.1, NM_001287519.1
NP_001274453.1, NM_001287524.1
NP_004349.1, NM_004358.4 [P30305-2]
NP_068658.1, NM_021872.3 [P30305-3]
NP_068659.1, NM_021873.3 [P30305-1]
UniGeneiHs.153752

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CWRX-ray2.10A370-580[»]
1CWSX-ray2.00A370-580[»]
1CWTX-ray2.30A388-565[»]
1QB0X-ray1.91A370-580[»]
1YM9X-ray2.00A391-564[»]
1YMDX-ray1.70A391-564[»]
1YMKX-ray1.70A391-564[»]
1YMLX-ray1.70A391-564[»]
1YS0X-ray2.00A391-564[»]
2A2KX-ray1.52A391-564[»]
2IFDX-ray2.00A391-564[»]
2IFVX-ray1.60A391-564[»]
2UZQX-ray2.38A/B/C/D/E/F391-580[»]
3FQTX-ray1.80C38-46[»]
3FQUX-ray1.80C38-46[»]
4WH7X-ray1.62A386-565[»]
4WH9X-ray1.50A386-565[»]
ProteinModelPortaliP30305
SMRiP30305
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107429, 100 interactors
DIPiDIP-323N
ELMiP30305
IntActiP30305, 16 interactors
MINTiP30305
STRINGi9606.ENSP00000245960

Chemistry databases

BindingDBiP30305
ChEMBLiCHEMBL4804
DrugBankiDB03661 Cysteinesulfonic Acid

PTM databases

DEPODiP30305
iPTMnetiP30305
PhosphoSitePlusiP30305

Polymorphism and mutation databases

DMDMi21264471

Proteomic databases

EPDiP30305
MaxQBiP30305
PaxDbiP30305
PeptideAtlasiP30305
PRIDEiP30305
ProteomicsDBi54654
54655 [P30305-2]
54656 [P30305-3]
54657 [P30305-4]

Protocols and materials databases

DNASUi994
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000245960; ENSP00000245960; ENSG00000101224 [P30305-1]
ENST00000340833; ENSP00000339170; ENSG00000101224 [P30305-3]
ENST00000439880; ENSP00000405972; ENSG00000101224 [P30305-2]
GeneIDi994
KEGGihsa:994
UCSCiuc002wjn.5 human [P30305-1]

Organism-specific databases

CTDi994
DisGeNETi994
EuPathDBiHostDB:ENSG00000101224.17
GeneCardsiCDC25B
HGNCiHGNC:1726 CDC25B
HPAiHPA038892
HPA038893
HPA075215
MIMi116949 gene
neXtProtiNX_P30305
OpenTargetsiENSG00000101224
PharmGKBiPA26260
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3772 Eukaryota
COG5105 LUCA
GeneTreeiENSGT00390000018747
HOVERGENiHBG052501
InParanoidiP30305
KOiK05866
OMAiNEQFSIR
OrthoDBiEOG091G0H0D
PhylomeDBiP30305
TreeFamiTF101056

Enzyme and pathway databases

BRENDAi3.1.3.48 2681
ReactomeiR-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8862803 Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
SIGNORiP30305

Miscellaneous databases

ChiTaRSiCDC25B human
EvolutionaryTraceiP30305
GeneWikiiCDC25B
GenomeRNAii994
PROiPR:P30305
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000101224 Expressed in 220 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_CDC25B
ExpressionAtlasiP30305 baseline and differential
GenevisibleiP30305 HS

Family and domain databases

CDDicd01530 Cdc25, 1 hit
Gene3Di3.40.250.10, 1 hit
InterProiView protein in InterPro
IPR000751 MPI_Phosphatase
IPR001763 Rhodanese-like_dom
IPR036873 Rhodanese-like_dom_sf
PfamiView protein in Pfam
PF06617 M-inducer_phosp, 1 hit
PF00581 Rhodanese, 1 hit
PRINTSiPR00716 MPIPHPHTASE
SMARTiView protein in SMART
SM00450 RHOD, 1 hit
SUPFAMiSSF52821 SSF52821, 1 hit
PROSITEiView protein in PROSITE
PS50206 RHODANESE_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMPIP2_HUMAN
AccessioniPrimary (citable) accession number: P30305
Secondary accession number(s): D3DVY1
, D3DVY2, D3DVY3, D3DVY4, O43551, Q13971, Q5JX77, Q6RSS1, Q9BRA6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: May 27, 2002
Last modified: November 7, 2018
This is version 194 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again