Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P30305 (MPIP2_HUMAN)

Entry version 213 (29 Sep 2021)
Sequence version 2 (27 May 2002)
Previous versions | rss
Add a publicationFeedback
Protein

M-phase inducer phosphatase 2

Gene

CDC25B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Directly dephosphorylates CDK1 and stimulates its kinase activity. The three isoforms seem to have a different level of activity.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Stimulated by B-type cyclins.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei4871

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.3.48, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P30305

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-69273, Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-69656, Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8862803, Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models

SIGNOR Signaling Network Open Resource

More...SIGNORi		P30305

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
M-phase inducer phosphatase 2 (EC:3.1.3.48)
Alternative name(s):
Dual specificity phosphatase Cdc25B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDC25B
Synonyms:CDC25HU2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1726, CDC25B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		116949, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P30305

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000101224

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		994

Open Targets

More...OpenTargetsi		ENSG00000101224

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA26260

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P30305, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4804

Drug and drug target database

More...DrugBanki		DB03661, L-cysteic acid

DrugCentral

More...DrugCentrali		P30305

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CDC25B

Domain mapping of disease mutations (DMDM)

More...DMDMi		21264471

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001986441 – 580M-phase inducer phosphatase 2Add BLAST580

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei42PhosphoserineBy similarity1
Modified residuei169Phosphoserine; by MELK1 Publication1
Modified residuei249PhosphoserineCombined sources1
Modified residuei323Phosphoserine; by MELK and MAPK14Combined sources3 Publications1
Modified residuei353Phosphoserine; by AURKACombined sources1 Publication1
Modified residuei375Phosphoserine; by BRSK1 and MAPK14Combined sources2 Publications1
Modified residuei470PhosphoserineCombined sources1
Modified residuei563PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by BRSK1 in vitro. Phosphorylated by CHEK1, which inhibits the activity of this protein. Phosphorylation at Ser-353 by AURKA might locally participate in the control of the onset of mitosis. Phosphorylation by MELK at Ser-169 promotes localization to the centrosome and the spindle poles during mitosis. Phosphorylation at Ser-323 and Ser-375 by MAPK14 is required for binding to 14-3-3 proteins.8 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-1253
CPTAC-1254

Encyclopedia of Proteome Dynamics

More...EPDi		P30305

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P30305

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P30305

MaxQB - The MaxQuant DataBase

More...MaxQBi		P30305

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P30305

PeptideAtlas

More...PeptideAtlasi		P30305

PRoteomics IDEntifications database

More...PRIDEi		P30305

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		54654 [P30305-1]
54655 [P30305-2]
54656 [P30305-3]
54657 [P30305-4]

PTM databases

DEPOD human dephosphorylation database

More...DEPODi		CDC25B

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P30305

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P30305

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000101224, Expressed in right hemisphere of cerebellum and 231 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P30305, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P30305, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000101224, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MAPK14 and 14-3-3 proteins.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107429, 122 interactors

Database of interacting proteins

More...DIPi		DIP-323N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P30305

Protein interaction database and analysis system

More...IntActi		P30305, 18 interactors

Molecular INTeraction database

More...MINTi		P30305

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000245960

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P30305

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P30305, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1580
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P30305

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P30305

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini431 – 538RhodanesePROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 24DisorderedSequence analysisAdd BLAST24
Regioni89 – 117DisorderedSequence analysisAdd BLAST29
Regioni165 – 196DisorderedSequence analysisAdd BLAST32
Regioni331 – 370DisorderedSequence analysisAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi89 – 111Polar residuesSequence analysisAdd BLAST23
Compositional biasi165 – 189Polar residuesSequence analysisAdd BLAST25
Compositional biasi334 – 370Basic and acidic residuesSequence analysisAdd BLAST37

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MPI phosphatase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3772, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158524

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P30305

Identification of Orthologs from Complete Genome Data

More...OMAi		CEPQNYR

Database for complete collections of gene phylogenies

More...PhylomeDBi		P30305

TreeFam database of animal gene trees

More...TreeFami		TF101056

Family and domain databases

Conserved Domains Database

More...CDDi		cd01530, Cdc25, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.250.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000751, MPI_Phosphatase
IPR001763, Rhodanese-like_dom
IPR036873, Rhodanese-like_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF06617, M-inducer_phosp, 1 hit
PF00581, Rhodanese, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00716, MPIPHPHTASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00450, RHOD, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52821, SSF52821, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50206, RHODANESE_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: P30305-1) [UniParc]FASTAAdd to basket
Also known as: CDC25B3

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVPQPEPAP GSALSPAGVC GGAQRPGHLP GLLLGSHGLL GSPVRAAASS 
        60         70         80         90        100
PVTTLTQTMH DLAGLGSETP KSQVGTLLFR SRSRLTHLSL SRRASESSLS 
       110        120        130        140        150
SESSESSDAG LCMDSPSPMD PHMAEQTFEQ AIQAASRIIR NEQFAIRRFQ 
       160        170        180        190        200
SMPVRLLGHS PVLRNITNSQ APDGRRKSEA GSGAASSSGE DKENDGFVFK 
       210        220        230        240        250
MPWKPTHPSS THALAEWASR REAFAQRPSS APDLMCLSPD RKMEVEELSP 
       260        270        280        290        300
LALGRFSLTP AEGDTEEDDG FVDILESDLK DDDAVPPGME SLISAPLVKT 
       310        320        330        340        350
LEKEEEKDLV MYSKCQRLFR SPSMPCSVIR PILKRLERPQ DRDTPVQNKR 
       360        370        380        390        400
RRSVTPPEEQ QEAEEPKARV LRSKSLCHDE IENLLDSDHR ELIGDYSKAF 
       410        420        430        440        450
LLQTVDGKHQ DLKYISPETM VALLTGKFSN IVDKFVIVDC RYPYEYEGGH 
       460        470        480        490        500
IKTAVNLPLE RDAESFLLKS PIAPCSLDKR VILIFHCEFS SERGPRMCRF 
       510        520        530        540        550
IRERDRAVND YPSLYYPEMY ILKGGYKEFF PQHPNFCEPQ DYRPMNHEAF 
       560        570        580
KDELKTFRLK TRSWAGERSR RELCSRLQDQ
Length:580
Mass (Da):64,987
Last modified:May 27, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEDE24B0E84AC1BE3
GO
Isoform 1 (identifier: P30305-2) [UniParc]FASTAAdd to basket
Also known as: CDC25B1

The sequence of this isoform differs from the canonical sequence as follows:
     68-81: Missing.

Show »
Length:566
Mass (Da):63,443
Checksum:i7C54E3E799ECDA50
GO
Isoform 2 (identifier: P30305-3) [UniParc]FASTAAdd to basket
Also known as: CDC25B2

The sequence of this isoform differs from the canonical sequence as follows:
     154-194: Missing.

Show »
Length:539
Mass (Da):60,756
Checksum:iCDA92929F8183BE9
GO
Isoform 4 (identifier: P30305-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-81: Missing.
     194-194: N → NVRFWKAGVGALREEEGACWGGSLACEDPPLPSWLQ

Show »
Length:601
Mass (Da):67,241
Checksum:i8E32AEC15A3845D7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G8JLH2G8JLH2_HUMAN
M-phase inducer phosphatase
CDC25B
489Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DIG0B4DIG0_HUMAN
M-phase inducer phosphatase
CDC25B
516Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti575S → D in AAB21139 (PubMed:1662986).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_020933548E → K1 PublicationCorresponds to variant dbSNP:rs11570019Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00086168 – 81Missing in isoform 1 and isoform 4. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_000862154 – 194Missing in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_012587194N → NVRFWKAGVGALREEEGACW GGSLACEDPPLPSWLQ in isoform 4. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M81934 mRNA Translation: AAA58416.1
S78187 mRNA Translation: AAB21139.1
X96436 Genomic DNA Translation: CAA65303.1
Z68092 mRNA Translation: CAA92108.1
AY494082 Genomic DNA Translation: AAR26469.1
AL109804 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10491.1
CH471133 Genomic DNA Translation: EAX10492.1
CH471133 Genomic DNA Translation: EAX10493.1
CH471133 Genomic DNA Translation: EAX10494.1
CH471133 Genomic DNA Translation: EAX10496.1
CH471133 Genomic DNA Translation: EAX10497.1
CH471133 Genomic DNA Translation: EAX10498.1
CH471133 Genomic DNA Translation: EAX10499.1
BC006395 mRNA Translation: AAH06395.1
BC009953 mRNA Translation: AAH09953.1
BC051711 mRNA Translation: AAH51711.1
AF036233 Genomic DNA Translation: AAB94622.1
AF036233 Genomic DNA Translation: AAB94624.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13065.1 [P30305-2]
CCDS13066.1 [P30305-3]
CCDS13067.1 [P30305-1]

Protein sequence database of the Protein Information Resource

More...PIRi		B41648

NCBI Reference Sequences

More...RefSeqi		NP_001274448.1, NM_001287519.1
NP_001274453.1, NM_001287524.1
NP_004349.1, NM_004358.4 [P30305-2]
NP_068658.1, NM_021872.3 [P30305-3]
NP_068659.1, NM_021873.3 [P30305-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000245960; ENSP00000245960; ENSG00000101224 [P30305-1]
ENST00000340833; ENSP00000339170; ENSG00000101224 [P30305-3]
ENST00000439880; ENSP00000405972; ENSG00000101224 [P30305-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		994

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:994

UCSC genome browser

More...UCSCi		uc002wjn.5, human [P30305-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M81934 mRNA Translation: AAA58416.1
S78187 mRNA Translation: AAB21139.1
X96436 Genomic DNA Translation: CAA65303.1
Z68092 mRNA Translation: CAA92108.1
AY494082 Genomic DNA Translation: AAR26469.1
AL109804 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10491.1
CH471133 Genomic DNA Translation: EAX10492.1
CH471133 Genomic DNA Translation: EAX10493.1
CH471133 Genomic DNA Translation: EAX10494.1
CH471133 Genomic DNA Translation: EAX10496.1
CH471133 Genomic DNA Translation: EAX10497.1
CH471133 Genomic DNA Translation: EAX10498.1
CH471133 Genomic DNA Translation: EAX10499.1
BC006395 mRNA Translation: AAH06395.1
BC009953 mRNA Translation: AAH09953.1
BC051711 mRNA Translation: AAH51711.1
AF036233 Genomic DNA Translation: AAB94622.1
AF036233 Genomic DNA Translation: AAB94624.1
CCDSiCCDS13065.1 [P30305-2]
CCDS13066.1 [P30305-3]
CCDS13067.1 [P30305-1]
PIRiB41648
RefSeqiNP_001274448.1, NM_001287519.1
NP_001274453.1, NM_001287524.1
NP_004349.1, NM_004358.4 [P30305-2]
NP_068658.1, NM_021872.3 [P30305-3]
NP_068659.1, NM_021873.3 [P30305-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CWRX-ray2.10A370-580[»]
1CWSX-ray2.00A370-580[»]
1CWTX-ray2.30A388-565[»]
1QB0X-ray1.91A370-580[»]
1YM9X-ray2.00A391-564[»]
1YMDX-ray1.70A391-564[»]
1YMKX-ray1.70A391-564[»]
1YMLX-ray1.70A391-564[»]
1YS0X-ray2.00A391-564[»]
2A2KX-ray1.52A391-564[»]
2IFDX-ray2.00A391-564[»]
2IFVX-ray1.60A391-564[»]
2UZQX-ray2.38A/B/C/D/E/F391-580[»]
3FQTX-ray1.80C38-46[»]
3FQUX-ray1.80C38-46[»]
4WH7X-ray1.62A386-565[»]
4WH9X-ray1.50A386-565[»]
SMRiP30305
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107429, 122 interactors
DIPiDIP-323N
ELMiP30305
IntActiP30305, 18 interactors
MINTiP30305
STRINGi9606.ENSP00000245960

Chemistry databases

BindingDBiP30305
ChEMBLiCHEMBL4804
DrugBankiDB03661, L-cysteic acid
DrugCentraliP30305

PTM databases

DEPODiCDC25B
iPTMnetiP30305
PhosphoSitePlusiP30305

Genetic variation databases

BioMutaiCDC25B
DMDMi21264471

Proteomic databases

CPTACiCPTAC-1253
CPTAC-1254
EPDiP30305
jPOSTiP30305
MassIVEiP30305
MaxQBiP30305
PaxDbiP30305
PeptideAtlasiP30305
PRIDEiP30305
ProteomicsDBi54654 [P30305-1]
54655 [P30305-2]
54656 [P30305-3]
54657 [P30305-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3625, 964 antibodies

The CPTC Antibody Portal

More...CPTCi		P30305, 2 antibodies

The DNASU plasmid repository

More...DNASUi		994

Genome annotation databases

EnsembliENST00000245960; ENSP00000245960; ENSG00000101224 [P30305-1]
ENST00000340833; ENSP00000339170; ENSG00000101224 [P30305-3]
ENST00000439880; ENSP00000405972; ENSG00000101224 [P30305-2]
GeneIDi994
KEGGihsa:994
UCSCiuc002wjn.5, human [P30305-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		994
DisGeNETi994

GeneCards: human genes, protein and diseases

More...GeneCardsi		CDC25B
HGNCiHGNC:1726, CDC25B
HPAiENSG00000101224, Low tissue specificity
MIMi116949, gene
neXtProtiNX_P30305
OpenTargetsiENSG00000101224
PharmGKBiPA26260
VEuPathDBiHostDB:ENSG00000101224

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3772, Eukaryota
GeneTreeiENSGT00940000158524
InParanoidiP30305
OMAiCEPQNYR
PhylomeDBiP30305
TreeFamiTF101056

Enzyme and pathway databases

BRENDAi3.1.3.48, 2681
PathwayCommonsiP30305
ReactomeiR-HSA-69273, Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-69656, Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8862803, Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models
SIGNORiP30305

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		994, 146 hits in 1026 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CDC25B, human
EvolutionaryTraceiP30305

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CDC25B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		994
PharosiP30305, Tchem

Protein Ontology

More...PROi		PR:P30305
RNActiP30305, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000101224, Expressed in right hemisphere of cerebellum and 231 other tissues
ExpressionAtlasiP30305, baseline and differential
GenevisibleiP30305, HS

Family and domain databases

CDDicd01530, Cdc25, 1 hit
Gene3Di3.40.250.10, 1 hit
InterProiView protein in InterPro
IPR000751, MPI_Phosphatase
IPR001763, Rhodanese-like_dom
IPR036873, Rhodanese-like_dom_sf
PfamiView protein in Pfam
PF06617, M-inducer_phosp, 1 hit
PF00581, Rhodanese, 1 hit
PRINTSiPR00716, MPIPHPHTASE
SMARTiView protein in SMART
SM00450, RHOD, 1 hit
SUPFAMiSSF52821, SSF52821, 1 hit
PROSITEiView protein in PROSITE
PS50206, RHODANESE_3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPIP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P30305
Secondary accession number(s): D3DVY1
, D3DVY2, D3DVY3, D3DVY4, O43551, Q13971, Q5JX77, Q6RSS1, Q9BRA6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: May 27, 2002
Last modified: September 29, 2021
This is version 213 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again