Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform

Gene

PPP2R1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein phosphatase regulator activity Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-163685 Integration of energy metabolism
R-HSA-163767 PP2A-mediated dephosphorylation of key metabolic factors
R-HSA-180024 DARPP-32 events
R-HSA-195253 Degradation of beta-catenin by the destruction complex
R-HSA-196299 Beta-catenin phosphorylation cascade
R-HSA-198753 ERK/MAPK targets
R-HSA-202670 ERKs are inactivated
R-HSA-2465910 MASTL Facilitates Mitotic Progression
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-389513 CTLA4 inhibitory signaling
R-HSA-432142 Platelet sensitization by LDL
R-HSA-4641262 Disassembly of the destruction complex and recruitment of AXIN to the membrane
R-HSA-5339716 Misspliced GSK3beta mutants stabilize beta-catenin
R-HSA-5358747 S33 mutants of beta-catenin aren't phosphorylated
R-HSA-5358749 S37 mutants of beta-catenin aren't phosphorylated
R-HSA-5358751 S45 mutants of beta-catenin aren't phosphorylated
R-HSA-5358752 T41 mutants of beta-catenin aren't phosphorylated
R-HSA-5467337 APC truncation mutants have impaired AXIN binding
R-HSA-5467340 AXIN missense mutants destabilize the destruction complex
R-HSA-5467348 Truncations of AMER1 destabilize the destruction complex
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-5673000 RAF activation
R-HSA-5675221 Negative regulation of MAPK pathway
R-HSA-6804757 Regulation of TP53 Degradation
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-68877 Mitotic Prometaphase
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-70171 Glycolysis

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P30154

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
Alternative name(s):
PP2A subunit A isoform PR65-beta
PP2A subunit A isoform R1-beta
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPP2R1B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000137713.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9303 PPP2R1B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603113 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P30154

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5519

MalaCards human disease database

More...
MalaCardsi
PPP2R1B

Open Targets

More...
OpenTargetsi
ENSG00000137713

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33667

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PPP2R1B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116241236

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000714032 – 601Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoformAdd BLAST600

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P30154

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P30154

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P30154

PeptideAtlas

More...
PeptideAtlasi
P30154

PRoteomics IDEntifications database

More...
PRIDEi
P30154

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P30154

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P30154

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000137713 Expressed in 220 organ(s), highest expression level in adipose tissue

CleanEx database of gene expression profiles

More...
CleanExi
HS_PPP2R1B

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P30154 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P30154 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004034
HPA018908

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with IPO9. Interacts with SGO1. Interacts with RAF1.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111511, 120 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P30154

Database of interacting proteins

More...
DIPi
DIP-36616N

Protein interaction database and analysis system

More...
IntActi
P30154, 79 interactors

Molecular INTeraction database

More...
MINTi
P30154

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000311344

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P30154

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P30154

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati20 – 58HEAT 1Add BLAST39
Repeati59 – 96HEAT 2Add BLAST38
Repeati97 – 135HEAT 3Add BLAST39
Repeati136 – 173HEAT 4Add BLAST38
Repeati174 – 212HEAT 5Add BLAST39
Repeati213 – 251HEAT 6Add BLAST39
Repeati252 – 290HEAT 7Add BLAST39
Repeati291 – 333HEAT 8Add BLAST43
Repeati334 – 372HEAT 9Add BLAST39
Repeati373 – 411HEAT 10Add BLAST39
Repeati412 – 450HEAT 11Add BLAST39
Repeati451 – 489HEAT 12Add BLAST39
Repeati490 – 528HEAT 13Add BLAST39
Repeati529 – 567HEAT 14Add BLAST39
Repeati568 – 601HEAT 15Add BLAST34

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0211 Eukaryota
ENOG410XQVI LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000110944

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000078539

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000011

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P30154

KEGG Orthology (KO)

More...
KOi
K03456

Identification of Orthologs from Complete Genome Data

More...
OMAi
NHFLRPR

Database of Orthologous Groups

More...
OrthoDBi
EOG091G045V

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P30154

TreeFam database of animal gene trees

More...
TreeFami
TF105552

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000357 HEAT
IPR021133 HEAT_type_2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02985 HEAT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50077 HEAT_REPEAT, 12 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P30154-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGASELGTG PGAAGGDGDD SLYPIAVLID ELRNEDVQLR LNSIKKLSTI
60 70 80 90 100
ALALGVERTR SELLPFLTDT IYDEDEVLLA LAEQLGNFTG LVGGPDFAHC
110 120 130 140 150
LLPPLENLAT VEETVVRDKA VESLRQISQE HTPVALEAYF VPLVKRLASG
160 170 180 190 200
DWFTSRTSAC GLFSVCYPRA SNAVKAEIRQ QFRSLCSDDT PMVRRAAASK
210 220 230 240 250
LGEFAKVLEL DSVKSEIVPL FTSLASDEQD SVRLLAVEAC VSIAQLLSQD
260 270 280 290 300
DLETLVMPTL RQAAEDKSWR VRYMVADRFS ELQKAMGPKI TLNDLIPAFQ
310 320 330 340 350
NLLKDCEAEV RAAAAHKVKE LGENLPIEDR ETIIMNQILP YIKELVSDTN
360 370 380 390 400
QHVKSALASV IMGLSTILGK ENTIEHLLPL FLAQLKDECP DVRLNIISNL
410 420 430 440 450
DCVNEVIGIR QLSQSLLPAI VELAEDAKWR VRLAIIEYMP LLAGQLGVEF
460 470 480 490 500
FDEKLNSLCM AWLVDHVYAI REAATNNLMK LVQKFGTEWA QNTIVPKVLV
510 520 530 540 550
MANDPNYLHR MTTLFCINAL SEACGQEITT KQMLPIVLKM AGDQVANVRF
560 570 580 590 600
NVAKSLQKIG PILDTNALQG EVKPVLQKLG QDEDMDVKYF AQEAISVLAL

A
Length:601
Mass (Da):66,214
Last modified:October 17, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i86AB20D7505210B0
GO
Isoform 2 (identifier: P30154-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD

Show »
Length:667
Mass (Da):73,585
Checksum:i726EA8A8FB0DEB23
GO
Isoform 3 (identifier: P30154-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-102: Missing.
     598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD

Note: No experimental confirmation available.
Show »
Length:603
Mass (Da):66,617
Checksum:i3FB011FD47C65810
GO
Isoform 4 (identifier: P30154-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     344-388: Missing.

Note: No experimental confirmation available.
Show »
Length:556
Mass (Da):61,314
Checksum:i1FFAFBC9A8C38FA2
GO
Isoform 5 (identifier: P30154-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-229: Missing.

Show »
Length:474
Mass (Da):52,214
Checksum:i6F8EEB7D9779BFB1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YDG7H0YDG7_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PHZ6E9PHZ6_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPI5E9PPI5_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNM7E9PNM7_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA59983 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence BAG59103 differs from that shown. Reason: Frameshift at position 540.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti74E → V in AAA59983 (PubMed:2159327).Curated1
Sequence conflicti178I → T in AAC63525 (PubMed:9795170).Curated1
Sequence conflicti178I → T in AAG39644 (PubMed:11313745).Curated1
Sequence conflicti178I → T in AAA59983 (PubMed:2159327).Curated1
Sequence conflicti211D → G in BAG57867 (PubMed:14702039).Curated1
Sequence conflicti411Q → R in AAA59983 (PubMed:2159327).Curated1
Sequence conflicti503N → S in BAG57867 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0228958G → R in a lung cancer patient. 1 PublicationCorresponds to variant dbSNP:rs142771326Ensembl.1
Natural variantiVAR_02289615G → A in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_02289765P → S in a lung cancer patient. 1 Publication1
Natural variantiVAR_00638490G → D in a lung cancer patient. 3 PublicationsCorresponds to variant dbSNP:rs1805076EnsemblClinVar.1
Natural variantiVAR_022898101L → P in a colon adenocarcinoma. 1 Publication1
Natural variantiVAR_022899343K → E in a lung cancer patient. 1 Publication1
Natural variantiVAR_022900365S → P in a colorectal cancer patient. 1 PublicationCorresponds to variant dbSNP:rs1442893893Ensembl.1
Natural variantiVAR_022901448V → A in a colon adenocarcinoma. 1 Publication1
Natural variantiVAR_022902498V → E in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_022903499L → I in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_022904500V → G in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_022905504D → G in a lung cancer patient. 1 PublicationCorresponds to variant dbSNP:rs973682124Ensembl.1
Natural variantiVAR_022906545V → A in a colon adenocarcinoma. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04337939 – 102Missing in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_046684103 – 229Missing in isoform 5. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_045275344 – 388Missing in isoform 4. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_036460598 – 601LALA → VAQRLRKLEFPVKDSGEPSV PRADKNHFPRPTVPGEDMGK GPVYQLRGDTRDTLAQLGIA ELVHFSQSTD in isoform 2 and isoform 3. 2 Publications4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF083439
, AF083425, AF083426, AF083427, AF083428, AF083429, AF083430, AF083431, AF083432, AF083433, AF083434, AF083435, AF083436, AF083437, AF083438 Genomic DNA Translation: AAC63525.1
AF087438 mRNA Translation: AAC69624.1
AF163473 mRNA Translation: AAG39644.1
AK294716 mRNA Translation: BAG57867.1
AK296455 mRNA Translation: BAG59103.1 Frameshift.
AK301705 mRNA Translation: BAG63177.1
EF445011 Genomic DNA Translation: ACA06046.1
EF445011 Genomic DNA Translation: ACA06047.1
AP000925 Genomic DNA No translation available.
AP001781 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67150.1
CH471065 Genomic DNA Translation: EAW67151.1
BC027596 mRNA Translation: AAH27596.1
M65254 mRNA Translation: AAA59983.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53706.1 [P30154-3]
CCDS53707.1 [P30154-5]
CCDS53708.1 [P30154-4]
CCDS8348.1 [P30154-2]
CCDS8349.1 [P30154-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
B34541

NCBI Reference Sequences

More...
RefSeqi
NP_001171033.1, NM_001177562.1 [P30154-4]
NP_001171034.1, NM_001177563.1 [P30154-5]
NP_002707.3, NM_002716.4 [P30154-1]
NP_859050.1, NM_181699.2 [P30154-2]
NP_859051.1, NM_181700.1 [P30154-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.269128
Hs.584790

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000311129; ENSP00000311344; ENSG00000137713 [P30154-2]
ENST00000341980; ENSP00000343317; ENSG00000137713 [P30154-4]
ENST00000393055; ENSP00000376775; ENSG00000137713 [P30154-5]
ENST00000426998; ENSP00000410671; ENSG00000137713 [P30154-3]
ENST00000527614; ENSP00000437193; ENSG00000137713 [P30154-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5519

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5519

UCSC genome browser

More...
UCSCi
uc001plw.2 human [P30154-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083439
, AF083425, AF083426, AF083427, AF083428, AF083429, AF083430, AF083431, AF083432, AF083433, AF083434, AF083435, AF083436, AF083437, AF083438 Genomic DNA Translation: AAC63525.1
AF087438 mRNA Translation: AAC69624.1
AF163473 mRNA Translation: AAG39644.1
AK294716 mRNA Translation: BAG57867.1
AK296455 mRNA Translation: BAG59103.1 Frameshift.
AK301705 mRNA Translation: BAG63177.1
EF445011 Genomic DNA Translation: ACA06046.1
EF445011 Genomic DNA Translation: ACA06047.1
AP000925 Genomic DNA No translation available.
AP001781 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67150.1
CH471065 Genomic DNA Translation: EAW67151.1
BC027596 mRNA Translation: AAH27596.1
M65254 mRNA Translation: AAA59983.1 Sequence problems.
CCDSiCCDS53706.1 [P30154-3]
CCDS53707.1 [P30154-5]
CCDS53708.1 [P30154-4]
CCDS8348.1 [P30154-2]
CCDS8349.1 [P30154-1]
PIRiB34541
RefSeqiNP_001171033.1, NM_001177562.1 [P30154-4]
NP_001171034.1, NM_001177563.1 [P30154-5]
NP_002707.3, NM_002716.4 [P30154-1]
NP_859050.1, NM_181699.2 [P30154-2]
NP_859051.1, NM_181700.1 [P30154-3]
UniGeneiHs.269128
Hs.584790

3D structure databases

ProteinModelPortaliP30154
SMRiP30154
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111511, 120 interactors
CORUMiP30154
DIPiDIP-36616N
IntActiP30154, 79 interactors
MINTiP30154
STRINGi9606.ENSP00000311344

PTM databases

iPTMnetiP30154
PhosphoSitePlusiP30154

Polymorphism and mutation databases

BioMutaiPPP2R1B
DMDMi116241236

Proteomic databases

EPDiP30154
MaxQBiP30154
PaxDbiP30154
PeptideAtlasiP30154
PRIDEiP30154

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5519
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311129; ENSP00000311344; ENSG00000137713 [P30154-2]
ENST00000341980; ENSP00000343317; ENSG00000137713 [P30154-4]
ENST00000393055; ENSP00000376775; ENSG00000137713 [P30154-5]
ENST00000426998; ENSP00000410671; ENSG00000137713 [P30154-3]
ENST00000527614; ENSP00000437193; ENSG00000137713 [P30154-1]
GeneIDi5519
KEGGihsa:5519
UCSCiuc001plw.2 human [P30154-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5519
DisGeNETi5519
EuPathDBiHostDB:ENSG00000137713.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PPP2R1B
HGNCiHGNC:9303 PPP2R1B
HPAiCAB004034
HPA018908
MalaCardsiPPP2R1B
MIMi603113 gene
neXtProtiNX_P30154
OpenTargetsiENSG00000137713
PharmGKBiPA33667

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0211 Eukaryota
ENOG410XQVI LUCA
GeneTreeiENSGT00730000110944
HOGENOMiHOG000078539
HOVERGENiHBG000011
InParanoidiP30154
KOiK03456
OMAiNHFLRPR
OrthoDBiEOG091G045V
PhylomeDBiP30154
TreeFamiTF105552

Enzyme and pathway databases

ReactomeiR-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-163685 Integration of energy metabolism
R-HSA-163767 PP2A-mediated dephosphorylation of key metabolic factors
R-HSA-180024 DARPP-32 events
R-HSA-195253 Degradation of beta-catenin by the destruction complex
R-HSA-196299 Beta-catenin phosphorylation cascade
R-HSA-198753 ERK/MAPK targets
R-HSA-202670 ERKs are inactivated
R-HSA-2465910 MASTL Facilitates Mitotic Progression
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-389513 CTLA4 inhibitory signaling
R-HSA-432142 Platelet sensitization by LDL
R-HSA-4641262 Disassembly of the destruction complex and recruitment of AXIN to the membrane
R-HSA-5339716 Misspliced GSK3beta mutants stabilize beta-catenin
R-HSA-5358747 S33 mutants of beta-catenin aren't phosphorylated
R-HSA-5358749 S37 mutants of beta-catenin aren't phosphorylated
R-HSA-5358751 S45 mutants of beta-catenin aren't phosphorylated
R-HSA-5358752 T41 mutants of beta-catenin aren't phosphorylated
R-HSA-5467337 APC truncation mutants have impaired AXIN binding
R-HSA-5467340 AXIN missense mutants destabilize the destruction complex
R-HSA-5467348 Truncations of AMER1 destabilize the destruction complex
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-5673000 RAF activation
R-HSA-5675221 Negative regulation of MAPK pathway
R-HSA-6804757 Regulation of TP53 Degradation
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-68877 Mitotic Prometaphase
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-70171 Glycolysis
SIGNORiP30154

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PPP2R1B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PPP2R1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5519

Protein Ontology

More...
PROi
PR:P30154

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000137713 Expressed in 220 organ(s), highest expression level in adipose tissue
CleanExiHS_PPP2R1B
ExpressionAtlasiP30154 baseline and differential
GenevisibleiP30154 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000357 HEAT
IPR021133 HEAT_type_2
PfamiView protein in Pfam
PF02985 HEAT, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50077 HEAT_REPEAT, 12 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei2AAB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P30154
Secondary accession number(s): A8MY67
, B0YJ69, B4DGQ6, B4DK91, B4DWW5, F8W8G1, O75620, Q8NHV8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 17, 2006
Last modified: December 5, 2018
This is version 180 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again