Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform

Gene

PPP2R1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.

GO - Molecular functioni

  • protein phosphatase regulator activity Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-163685 Integration of energy metabolism
R-HSA-163767 PP2A-mediated dephosphorylation of key metabolic factors
R-HSA-180024 DARPP-32 events
R-HSA-195253 Degradation of beta-catenin by the destruction complex
R-HSA-196299 Beta-catenin phosphorylation cascade
R-HSA-198753 ERK/MAPK targets
R-HSA-202670 ERKs are inactivated
R-HSA-2465910 MASTL Facilitates Mitotic Progression
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-389513 CTLA4 inhibitory signaling
R-HSA-432142 Platelet sensitization by LDL
R-HSA-4641262 Disassembly of the destruction complex and recruitment of AXIN to the membrane
R-HSA-5339716 Misspliced GSK3beta mutants stabilize beta-catenin
R-HSA-5358747 S33 mutants of beta-catenin aren't phosphorylated
R-HSA-5358749 S37 mutants of beta-catenin aren't phosphorylated
R-HSA-5358751 S45 mutants of beta-catenin aren't phosphorylated
R-HSA-5358752 T41 mutants of beta-catenin aren't phosphorylated
R-HSA-5467337 APC truncation mutants have impaired AXIN binding
R-HSA-5467340 AXIN missense mutants destabilize the destruction complex
R-HSA-5467348 Truncations of AMER1 destabilize the destruction complex
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-5673000 RAF activation
R-HSA-5675221 Negative regulation of MAPK pathway
R-HSA-6804757 Regulation of TP53 Degradation
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-68877 Mitotic Prometaphase
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-70171 Glycolysis
SIGNORiP30154

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
Alternative name(s):
PP2A subunit A isoform PR65-beta
PP2A subunit A isoform R1-beta
Gene namesi
Name:PPP2R1B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000137713.15
HGNCiHGNC:9303 PPP2R1B
MIMi603113 gene
neXtProtiNX_P30154

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi5519
MalaCardsiPPP2R1B
OpenTargetsiENSG00000137713
PharmGKBiPA33667

Polymorphism and mutation databases

BioMutaiPPP2R1B
DMDMi116241236

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000714032 – 601Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoformAdd BLAST600

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiP30154
MaxQBiP30154
PaxDbiP30154
PeptideAtlasiP30154
PRIDEiP30154

PTM databases

iPTMnetiP30154
PhosphoSitePlusiP30154

Expressioni

Gene expression databases

BgeeiENSG00000137713 Expressed in 220 organ(s), highest expression level in adipose tissue
CleanExiHS_PPP2R1B
ExpressionAtlasiP30154 baseline and differential
GenevisibleiP30154 HS

Organism-specific databases

HPAiCAB004034
HPA018908

Interactioni

Subunit structurei

PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. Interacts with IPO9. Interacts with SGO1. Interacts with RAF1.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi111511, 118 interactors
CORUMiP30154
DIPiDIP-36616N
IntActiP30154, 79 interactors
MINTiP30154
STRINGi9606.ENSP00000311344

Structurei

3D structure databases

ProteinModelPortaliP30154
SMRiP30154
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati20 – 58HEAT 1Add BLAST39
Repeati59 – 96HEAT 2Add BLAST38
Repeati97 – 135HEAT 3Add BLAST39
Repeati136 – 173HEAT 4Add BLAST38
Repeati174 – 212HEAT 5Add BLAST39
Repeati213 – 251HEAT 6Add BLAST39
Repeati252 – 290HEAT 7Add BLAST39
Repeati291 – 333HEAT 8Add BLAST43
Repeati334 – 372HEAT 9Add BLAST39
Repeati373 – 411HEAT 10Add BLAST39
Repeati412 – 450HEAT 11Add BLAST39
Repeati451 – 489HEAT 12Add BLAST39
Repeati490 – 528HEAT 13Add BLAST39
Repeati529 – 567HEAT 14Add BLAST39
Repeati568 – 601HEAT 15Add BLAST34

Domaini

Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.

Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0211 Eukaryota
ENOG410XQVI LUCA
GeneTreeiENSGT00730000110944
HOGENOMiHOG000078539
HOVERGENiHBG000011
InParanoidiP30154
KOiK03456
OMAiNHFLRPR
OrthoDBiEOG091G045V
PhylomeDBiP30154
TreeFamiTF105552

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000357 HEAT
IPR021133 HEAT_type_2
PfamiView protein in Pfam
PF02985 HEAT, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50077 HEAT_REPEAT, 12 hits

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P30154-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGASELGTG PGAAGGDGDD SLYPIAVLID ELRNEDVQLR LNSIKKLSTI
60 70 80 90 100
ALALGVERTR SELLPFLTDT IYDEDEVLLA LAEQLGNFTG LVGGPDFAHC
110 120 130 140 150
LLPPLENLAT VEETVVRDKA VESLRQISQE HTPVALEAYF VPLVKRLASG
160 170 180 190 200
DWFTSRTSAC GLFSVCYPRA SNAVKAEIRQ QFRSLCSDDT PMVRRAAASK
210 220 230 240 250
LGEFAKVLEL DSVKSEIVPL FTSLASDEQD SVRLLAVEAC VSIAQLLSQD
260 270 280 290 300
DLETLVMPTL RQAAEDKSWR VRYMVADRFS ELQKAMGPKI TLNDLIPAFQ
310 320 330 340 350
NLLKDCEAEV RAAAAHKVKE LGENLPIEDR ETIIMNQILP YIKELVSDTN
360 370 380 390 400
QHVKSALASV IMGLSTILGK ENTIEHLLPL FLAQLKDECP DVRLNIISNL
410 420 430 440 450
DCVNEVIGIR QLSQSLLPAI VELAEDAKWR VRLAIIEYMP LLAGQLGVEF
460 470 480 490 500
FDEKLNSLCM AWLVDHVYAI REAATNNLMK LVQKFGTEWA QNTIVPKVLV
510 520 530 540 550
MANDPNYLHR MTTLFCINAL SEACGQEITT KQMLPIVLKM AGDQVANVRF
560 570 580 590 600
NVAKSLQKIG PILDTNALQG EVKPVLQKLG QDEDMDVKYF AQEAISVLAL

A
Length:601
Mass (Da):66,214
Last modified:October 17, 2006 - v3
Checksum:i86AB20D7505210B0
GO
Isoform 2 (identifier: P30154-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD

Show »
Length:667
Mass (Da):73,585
Checksum:i726EA8A8FB0DEB23
GO
Isoform 3 (identifier: P30154-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-102: Missing.
     598-601: LALA → VAQRLRKLEFPVKDSGEPSVPRADKNHFPRPTVPGEDMGKGPVYQLRGDTRDTLAQLGIAELVHFSQSTD

Note: No experimental confirmation available.
Show »
Length:603
Mass (Da):66,617
Checksum:i3FB011FD47C65810
GO
Isoform 4 (identifier: P30154-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     344-388: Missing.

Note: No experimental confirmation available.
Show »
Length:556
Mass (Da):61,314
Checksum:i1FFAFBC9A8C38FA2
GO
Isoform 5 (identifier: P30154-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-229: Missing.

Show »
Length:474
Mass (Da):52,214
Checksum:i6F8EEB7D9779BFB1
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PHZ6E9PHZ6_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
135Annotation score:
H0YDG7H0YDG7_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
224Annotation score:
E9PPI5E9PPI5_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
83Annotation score:
E9PNM7E9PNM7_HUMAN
Serine/threonine-protein phosphatas...
PPP2R1B
119Annotation score:

Sequence cautioni

The sequence AAA59983 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence BAG59103 differs from that shown. Reason: Frameshift at position 540.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti74E → V in AAA59983 (PubMed:2159327).Curated1
Sequence conflicti178I → T in AAC63525 (PubMed:9795170).Curated1
Sequence conflicti178I → T in AAG39644 (PubMed:11313745).Curated1
Sequence conflicti178I → T in AAA59983 (PubMed:2159327).Curated1
Sequence conflicti211D → G in BAG57867 (PubMed:14702039).Curated1
Sequence conflicti411Q → R in AAA59983 (PubMed:2159327).Curated1
Sequence conflicti503N → S in BAG57867 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0228958G → R in a lung cancer patient. 1 PublicationCorresponds to variant dbSNP:rs142771326Ensembl.1
Natural variantiVAR_02289615G → A in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_02289765P → S in a lung cancer patient. 1 Publication1
Natural variantiVAR_00638490G → D in a lung cancer patient. 3 PublicationsCorresponds to variant dbSNP:rs1805076EnsemblClinVar.1
Natural variantiVAR_022898101L → P in a colon adenocarcinoma. 1 Publication1
Natural variantiVAR_022899343K → E in a lung cancer patient. 1 Publication1
Natural variantiVAR_022900365S → P in a colorectal cancer patient. 1 PublicationCorresponds to variant dbSNP:rs1442893893Ensembl.1
Natural variantiVAR_022901448V → A in a colon adenocarcinoma. 1 Publication1
Natural variantiVAR_022902498V → E in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_022903499L → I in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_022904500V → G in a colorectal cancer patient. 1 Publication1
Natural variantiVAR_022905504D → G in a lung cancer patient. 1 PublicationCorresponds to variant dbSNP:rs973682124Ensembl.1
Natural variantiVAR_022906545V → A in a colon adenocarcinoma. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04337939 – 102Missing in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_046684103 – 229Missing in isoform 5. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_045275344 – 388Missing in isoform 4. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_036460598 – 601LALA → VAQRLRKLEFPVKDSGEPSV PRADKNHFPRPTVPGEDMGK GPVYQLRGDTRDTLAQLGIA ELVHFSQSTD in isoform 2 and isoform 3. 2 Publications4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083439
, AF083425, AF083426, AF083427, AF083428, AF083429, AF083430, AF083431, AF083432, AF083433, AF083434, AF083435, AF083436, AF083437, AF083438 Genomic DNA Translation: AAC63525.1
AF087438 mRNA Translation: AAC69624.1
AF163473 mRNA Translation: AAG39644.1
AK294716 mRNA Translation: BAG57867.1
AK296455 mRNA Translation: BAG59103.1 Frameshift.
AK301705 mRNA Translation: BAG63177.1
EF445011 Genomic DNA Translation: ACA06046.1
EF445011 Genomic DNA Translation: ACA06047.1
AP000925 Genomic DNA No translation available.
AP001781 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67150.1
CH471065 Genomic DNA Translation: EAW67151.1
BC027596 mRNA Translation: AAH27596.1
M65254 mRNA Translation: AAA59983.1 Sequence problems.
CCDSiCCDS53706.1 [P30154-3]
CCDS53707.1 [P30154-5]
CCDS53708.1 [P30154-4]
CCDS8348.1 [P30154-2]
CCDS8349.1 [P30154-1]
PIRiB34541
RefSeqiNP_001171033.1, NM_001177562.1 [P30154-4]
NP_001171034.1, NM_001177563.1 [P30154-5]
NP_002707.3, NM_002716.4 [P30154-1]
NP_859050.1, NM_181699.2 [P30154-2]
NP_859051.1, NM_181700.1 [P30154-3]
UniGeneiHs.269128
Hs.584790

Genome annotation databases

EnsembliENST00000311129; ENSP00000311344; ENSG00000137713 [P30154-2]
ENST00000341980; ENSP00000343317; ENSG00000137713 [P30154-4]
ENST00000393055; ENSP00000376775; ENSG00000137713 [P30154-5]
ENST00000426998; ENSP00000410671; ENSG00000137713 [P30154-3]
ENST00000527614; ENSP00000437193; ENSG00000137713 [P30154-1]
GeneIDi5519
KEGGihsa:5519
UCSCiuc001plw.2 human [P30154-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF083439
, AF083425, AF083426, AF083427, AF083428, AF083429, AF083430, AF083431, AF083432, AF083433, AF083434, AF083435, AF083436, AF083437, AF083438 Genomic DNA Translation: AAC63525.1
AF087438 mRNA Translation: AAC69624.1
AF163473 mRNA Translation: AAG39644.1
AK294716 mRNA Translation: BAG57867.1
AK296455 mRNA Translation: BAG59103.1 Frameshift.
AK301705 mRNA Translation: BAG63177.1
EF445011 Genomic DNA Translation: ACA06046.1
EF445011 Genomic DNA Translation: ACA06047.1
AP000925 Genomic DNA No translation available.
AP001781 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67150.1
CH471065 Genomic DNA Translation: EAW67151.1
BC027596 mRNA Translation: AAH27596.1
M65254 mRNA Translation: AAA59983.1 Sequence problems.
CCDSiCCDS53706.1 [P30154-3]
CCDS53707.1 [P30154-5]
CCDS53708.1 [P30154-4]
CCDS8348.1 [P30154-2]
CCDS8349.1 [P30154-1]
PIRiB34541
RefSeqiNP_001171033.1, NM_001177562.1 [P30154-4]
NP_001171034.1, NM_001177563.1 [P30154-5]
NP_002707.3, NM_002716.4 [P30154-1]
NP_859050.1, NM_181699.2 [P30154-2]
NP_859051.1, NM_181700.1 [P30154-3]
UniGeneiHs.269128
Hs.584790

3D structure databases

ProteinModelPortaliP30154
SMRiP30154
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111511, 118 interactors
CORUMiP30154
DIPiDIP-36616N
IntActiP30154, 79 interactors
MINTiP30154
STRINGi9606.ENSP00000311344

PTM databases

iPTMnetiP30154
PhosphoSitePlusiP30154

Polymorphism and mutation databases

BioMutaiPPP2R1B
DMDMi116241236

Proteomic databases

EPDiP30154
MaxQBiP30154
PaxDbiP30154
PeptideAtlasiP30154
PRIDEiP30154

Protocols and materials databases

DNASUi5519
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000311129; ENSP00000311344; ENSG00000137713 [P30154-2]
ENST00000341980; ENSP00000343317; ENSG00000137713 [P30154-4]
ENST00000393055; ENSP00000376775; ENSG00000137713 [P30154-5]
ENST00000426998; ENSP00000410671; ENSG00000137713 [P30154-3]
ENST00000527614; ENSP00000437193; ENSG00000137713 [P30154-1]
GeneIDi5519
KEGGihsa:5519
UCSCiuc001plw.2 human [P30154-1]

Organism-specific databases

CTDi5519
DisGeNETi5519
EuPathDBiHostDB:ENSG00000137713.15
GeneCardsiPPP2R1B
HGNCiHGNC:9303 PPP2R1B
HPAiCAB004034
HPA018908
MalaCardsiPPP2R1B
MIMi603113 gene
neXtProtiNX_P30154
OpenTargetsiENSG00000137713
PharmGKBiPA33667
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0211 Eukaryota
ENOG410XQVI LUCA
GeneTreeiENSGT00730000110944
HOGENOMiHOG000078539
HOVERGENiHBG000011
InParanoidiP30154
KOiK03456
OMAiNHFLRPR
OrthoDBiEOG091G045V
PhylomeDBiP30154
TreeFamiTF105552

Enzyme and pathway databases

ReactomeiR-HSA-113501 Inhibition of replication initiation of damaged DNA by RB1/E2F1
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-163685 Integration of energy metabolism
R-HSA-163767 PP2A-mediated dephosphorylation of key metabolic factors
R-HSA-180024 DARPP-32 events
R-HSA-195253 Degradation of beta-catenin by the destruction complex
R-HSA-196299 Beta-catenin phosphorylation cascade
R-HSA-198753 ERK/MAPK targets
R-HSA-202670 ERKs are inactivated
R-HSA-2465910 MASTL Facilitates Mitotic Progression
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-389513 CTLA4 inhibitory signaling
R-HSA-432142 Platelet sensitization by LDL
R-HSA-4641262 Disassembly of the destruction complex and recruitment of AXIN to the membrane
R-HSA-5339716 Misspliced GSK3beta mutants stabilize beta-catenin
R-HSA-5358747 S33 mutants of beta-catenin aren't phosphorylated
R-HSA-5358749 S37 mutants of beta-catenin aren't phosphorylated
R-HSA-5358751 S45 mutants of beta-catenin aren't phosphorylated
R-HSA-5358752 T41 mutants of beta-catenin aren't phosphorylated
R-HSA-5467337 APC truncation mutants have impaired AXIN binding
R-HSA-5467340 AXIN missense mutants destabilize the destruction complex
R-HSA-5467348 Truncations of AMER1 destabilize the destruction complex
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-5673000 RAF activation
R-HSA-5675221 Negative regulation of MAPK pathway
R-HSA-6804757 Regulation of TP53 Degradation
R-HSA-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-HSA-68877 Mitotic Prometaphase
R-HSA-69231 Cyclin D associated events in G1
R-HSA-69273 Cyclin A/B1/B2 associated events during G2/M transition
R-HSA-70171 Glycolysis
SIGNORiP30154

Miscellaneous databases

ChiTaRSiPPP2R1B human
GeneWikiiPPP2R1B
GenomeRNAii5519
PROiPR:P30154
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000137713 Expressed in 220 organ(s), highest expression level in adipose tissue
CleanExiHS_PPP2R1B
ExpressionAtlasiP30154 baseline and differential
GenevisibleiP30154 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000357 HEAT
IPR021133 HEAT_type_2
PfamiView protein in Pfam
PF02985 HEAT, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50077 HEAT_REPEAT, 12 hits
ProtoNetiSearch...

Entry informationi

Entry namei2AAB_HUMAN
AccessioniPrimary (citable) accession number: P30154
Secondary accession number(s): A8MY67
, B0YJ69, B4DGQ6, B4DK91, B4DWW5, F8W8G1, O75620, Q8NHV8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 17, 2006
Last modified: November 7, 2018
This is version 179 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again