Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P29533 (VCAM1_MOUSE)

Entry version 186 (22 Apr 2020)
Sequence version 1 (01 Apr 1993)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Vascular cell adhesion protein 1

Gene

Vcam1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with integrin alpha-4/beta-1 (ITGA4/ITGB1) on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/ITGA4/ITGB1 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion, Host-virus interaction

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-216083 Integrin cell surface interactions

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vascular cell adhesion protein 1
Short name:
V-CAM 1
Short name:
VCAM-1
Alternative name(s):
CD_antigen: CD106
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Vcam1
Synonyms:Vcam-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:98926 Vcam1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini25 – 698ExtracellularSequence analysisAdd BLAST674
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei699 – 720HelicalSequence analysisAdd BLAST22
Topological domaini721 – 739CytoplasmicSequence analysisAdd BLAST19

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24CuratedAdd BLAST24
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001499825 – 739Vascular cell adhesion protein 1Add BLAST715

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi47 ↔ 95PROSITE-ProRule annotation
Disulfide bondi52 ↔ 99PROSITE-ProRule annotation
Disulfide bondi137 ↔ 195PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi225N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi246 ↔ 291PROSITE-ProRule annotation
Glycosylationi273N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi335 ↔ 383PROSITE-ProRule annotation
Glycosylationi424N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi531N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi534 ↔ 579PROSITE-ProRule annotation
Glycosylationi561N-linked (GlcNAc...) asparagine1 Publication1
Isoform 2 (identifier: P29533-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi319GPI-anchor amidated asparagine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		non-CPTAC-3397

MaxQB - The MaxQuant DataBase

More...MaxQBi		P29533

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P29533

PeptideAtlas

More...PeptideAtlasi		P29533

PRoteomics IDEntifications database

More...PRIDEi		P29533

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		2815

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P29533

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P29533

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed on inflamed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflamed tissue. Expressed in the bone marrow.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000027962 Expressed in spleen and 277 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P29533 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

(Microbial infection) Interacts with ECMV-D capsid proteins and acts as a receptor for this virus.

1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		204505, 1 interactor

Database of interacting proteins

More...DIPi		DIP-29097N

Protein interaction database and analysis system

More...IntActi		P29533, 2 interactors

Molecular INTeraction database

More...MINTi		P29533

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000029574

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P29533 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 111Ig-like C2-type 1Add BLAST87
Domaini119 – 212Ig-like C2-type 2Add BLAST94
Domaini223 – 309Ig-like C2-type 3Add BLAST87
Domaini312 – 393Ig-like C2-type 4Add BLAST82
Domaini408 – 506Ig-like C2-type 5Add BLAST99
Domaini511 – 595Ig-like C2-type 6Add BLAST85
Domaini600 – 682Ig-like C2-type 7Add BLAST83

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IIKS Eukaryota
ENOG4111F4V LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156511

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P29533

Database for complete collections of gene phylogenies

More...PhylomeDBi		P29533

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 7 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003987 ICAM_VCAM_N
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR008424 Ig_C2-set
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013151 Immunoglobulin
IPR003989 VCAM-1

The PANTHER Classification System

More...PANTHERi		PTHR13771:SF14 PTHR13771:SF14, 3 hits

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05790 C2-set, 2 hits
PF07679 I-set, 3 hits
PF00047 ig, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01472 ICAMVCAM1
PR01474 VCAM1

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726 SSF48726, 7 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835 IG_LIKE, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P29533-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVKMVAVLG ASTVLWILFA VSQAFKIEIS PEYKTIAQIG DSMALTCSTT 
        60         70         80         90        100
GCESPLFSWR TQIDSPLNAK VRTEGSKSVL TMEPVSFENE HSYLCTATCG 
       110        120        130        140        150
SGKLERSIHV DIYSFPKDPE IQFSGPLEVG KPVTVKCLAP DIYPVYRLEI 
       160        170        180        190        200
DLFKGDQLMN RQEFSSEEMT KSLETKSLEV TFTPVIEDIG KALVCRAKLH 
       210        220        230        240        250
IDQIDSTLKE RETVKELQVY ISPRNTTISV HPSTRLQEGG AVTMTCSSEG 
       260        270        280        290        300
LPAPEIFWGR KLDNEVLQLL SGNATLTLIA MRMEDSGVYV CEGVNLIGRD 
       310        320        330        340        350
KAEVELVVQE KPFIVDISPG SQVAAQVGDS VVLTCAAIGC DSPSFSWRTQ 
       360        370        380        390        400
TDSPLNGVVR NEGAKSTLVL SSVGFEDEHS YLCAVTCLQR TLEKRTQVEV 
       410        420        430        440        450
YSFPEDPVIK MSGPLVHGRP VTVNCTVPNV YPFDHLEIEL LKGETTLMKK 
       460        470        480        490        500
YFLEEMGIKS LETKILETTF IPTIEDTGKS LVCLARLHSG EMESEPKQRQ 
       510        520        530        540        550
SVQPLYVNVA PKETTIWVSP SPILEEGSPV NLTCSSDGIP APKILWSRQL 
       560        570        580        590        600
NNGELQPLSE NTTLTFMSTK RDDSGIYVCE GINEAGISRK SVELIIQVSP 
       610        620        630        640        650
KDIQLTVFPS KSVKEGDTVI ISCTCGNVPE TWIILKKKAK TGDMVLKSVD 
       660        670        680        690        700
GSYTIRQAQL QDAGIYECES KTEVGSQLRS LTLDVKGKEH NKDYFSPELL 
       710        720        730 
ALYCASSLVI PAIGMIVYFA RKANMKGSYS LVEAQKSKV
Length:739
Mass (Da):81,317
Last modified:April 1, 1993 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3D2134C341E5E449
GO
Isoform 2 (identifier: P29533-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     310-345: EKPFIVDISPGSQVAAQVGDSVVLTCAAIGCDSPSF → DGRMKSQITNGHQLTVHLMFAKSFYFICYLCLYLAL
     346-739: Missing.

Show »
Length:345
Mass (Da):38,372
Checksum:i973A28A199C6EA15
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UPN1Q3UPN1_MOUSE
Vascular cell adhesion protein 1
Vcam1
739Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JFP9A0A0G2JFP9_MOUSE
Vascular cell adhesion protein 1
Vcam1
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti693D → N in AAA16921 (PubMed:7507076).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002581310 – 345EKPFI…DSPSF → DGRMKSQITNGHQLTVHLMF AKSFYFICYLCLYLAL in isoform 2. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_002582346 – 739Missing in isoform 2. 3 PublicationsAdd BLAST394

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M84487 mRNA Translation: AAA40545.1
X67783 mRNA Translation: CAA47989.1
L22355 L22354 Genomic DNA Translation: AAA16921.1
L22350, L22301, L22349 Genomic DNA Translation: AAA16920.1
U12878 Genomic DNA Translation: AAB60659.1 Sequence problems.
U12879 Genomic DNA Translation: AAB60660.1 Sequence problems.
U12880 Genomic DNA Translation: AAB60661.1 Sequence problems.
U12874 Genomic DNA Translation: AAB60662.1 Sequence problems.
U12871 Genomic DNA Translation: AAB60663.1 Sequence problems.
U12883 Genomic DNA Translation: AAB60664.1 Sequence problems.
U12881 Genomic DNA Translation: AAA80010.1 Sequence problems.
U12882 Genomic DNA Translation: AAA80011.1 Sequence problems.
U12875 Genomic DNA Translation: AAA80012.1 Sequence problems.
U12872 Genomic DNA Translation: AAA80013.1 Sequence problems.
U12876 Genomic DNA Translation: AAA80014.1 Sequence problems.
U12873 Genomic DNA Translation: AAA80015.1 Sequence problems.
U12877 Genomic DNA Translation: AAA80016.1 Sequence problems.
L08431 mRNA Translation: AAA40546.1
U12884 mRNA Translation: AAA64832.1
L12541 mRNA Translation: AAC37607.1
U42327 Genomic DNA Translation: AAB88576.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS17785.1 [P29533-1]

Protein sequence database of the Protein Information Resource

More...PIRi		B48919 A46052
JN0581

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000196449; ENSMUSP00000142876; ENSMUSG00000027962 [P29533-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

VCAM-1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M84487 mRNA Translation: AAA40545.1
X67783 mRNA Translation: CAA47989.1
L22355 L22354 Genomic DNA Translation: AAA16921.1
L22350, L22301, L22349 Genomic DNA Translation: AAA16920.1
U12878 Genomic DNA Translation: AAB60659.1 Sequence problems.
U12879 Genomic DNA Translation: AAB60660.1 Sequence problems.
U12880 Genomic DNA Translation: AAB60661.1 Sequence problems.
U12874 Genomic DNA Translation: AAB60662.1 Sequence problems.
U12871 Genomic DNA Translation: AAB60663.1 Sequence problems.
U12883 Genomic DNA Translation: AAB60664.1 Sequence problems.
U12881 Genomic DNA Translation: AAA80010.1 Sequence problems.
U12882 Genomic DNA Translation: AAA80011.1 Sequence problems.
U12875 Genomic DNA Translation: AAA80012.1 Sequence problems.
U12872 Genomic DNA Translation: AAA80013.1 Sequence problems.
U12876 Genomic DNA Translation: AAA80014.1 Sequence problems.
U12873 Genomic DNA Translation: AAA80015.1 Sequence problems.
U12877 Genomic DNA Translation: AAA80016.1 Sequence problems.
L08431 mRNA Translation: AAA40546.1
U12884 mRNA Translation: AAA64832.1
L12541 mRNA Translation: AAC37607.1
U42327 Genomic DNA Translation: AAB88576.1
CCDSiCCDS17785.1 [P29533-1]
PIRiB48919 A46052
JN0581

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi204505, 1 interactor
DIPiDIP-29097N
IntActiP29533, 2 interactors
MINTiP29533
STRINGi10090.ENSMUSP00000029574

PTM databases

GlyConnecti2815
iPTMnetiP29533
PhosphoSitePlusiP29533

Proteomic databases

CPTACinon-CPTAC-3397
MaxQBiP29533
PaxDbiP29533
PeptideAtlasiP29533
PRIDEiP29533

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3955 1984 antibodies

Genome annotation databases

EnsembliENSMUST00000196449; ENSMUSP00000142876; ENSMUSG00000027962 [P29533-2]

Organism-specific databases

MGIiMGI:98926 Vcam1

Phylogenomic databases

eggNOGiENOG410IIKS Eukaryota
ENOG4111F4V LUCA
GeneTreeiENSGT00940000156511
InParanoidiP29533
PhylomeDBiP29533

Enzyme and pathway databases

ReactomeiR-MMU-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-MMU-216083 Integrin cell surface interactions

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Vcam1 mouse

Protein Ontology

More...PROi		PR:P29533
RNActiP29533 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000027962 Expressed in spleen and 277 other tissues
ExpressionAtlasiP29533 baseline and differential

Family and domain databases

Gene3Di2.60.40.10, 7 hits
InterProiView protein in InterPro
IPR003987 ICAM_VCAM_N
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR008424 Ig_C2-set
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013151 Immunoglobulin
IPR003989 VCAM-1
PANTHERiPTHR13771:SF14 PTHR13771:SF14, 3 hits
PfamiView protein in Pfam
PF05790 C2-set, 2 hits
PF07679 I-set, 3 hits
PF00047 ig, 1 hit
PRINTSiPR01472 ICAMVCAM1
PR01474 VCAM1
SMARTiView protein in SMART
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SUPFAMiSSF48726 SSF48726, 7 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVCAM1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P29533
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: April 22, 2020
This is version 186 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again