Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 212 (10 Apr 2019)
Sequence version 2 (01 Oct 1996)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Nitric oxide synthase, brain

Gene

NOS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Stimulated by calcium/calmodulin. Inhibited by n-Nos-inhibiting protein (PIN) which may prevent the dimerization of the protein. Inhibited by NOSIP.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi420Iron (heme axial ligand)By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi886 – 917FMNPROSITE-ProRule annotationAdd BLAST32
Nucleotide bindingi1032 – 1043FADBy similarityAdd BLAST12
Nucleotide bindingi1175 – 1185FADBy similarityAdd BLAST11
Nucleotide bindingi1250 – 1268NADPBy similarityAdd BLAST19
Nucleotide bindingi1348 – 1363NADPBy similarityAdd BLAST16

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • arginine binding Source: BHF-UCL
  • cadmium ion binding Source: BHF-UCL
  • calmodulin binding Source: UniProtKB-KW
  • flavin adenine dinucleotide binding Source: BHF-UCL
  • FMN binding Source: BHF-UCL
  • heme binding Source: BHF-UCL
  • ion channel binding Source: BHF-UCL
  • NADP binding Source: BHF-UCL
  • NADPH-hemoprotein reductase activity Source: GO_Central
  • nitric-oxide synthase activity Source: CACAO
  • oxidoreductase activity Source: GO_Central
  • scaffold protein binding Source: BHF-UCL
  • sodium channel regulator activity Source: BHF-UCL
  • tetrahydrobiopterin binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Oxidoreductase
LigandFAD, Flavoprotein, FMN, Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS01647-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.14.13.39 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1222556 ROS, RNS production in phagocytes
R-HSA-392154 Nitric oxide stimulates guanylate cyclase
R-HSA-5578775 Ion homeostasis

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P29475

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nitric oxide synthase, brain (EC:1.14.13.39)
Alternative name(s):
Constitutive NOS
NC-NOS
NOS type I
Neuronal NOS
Short name:
N-NOS
Short name:
nNOS
Peptidyl-cysteine S-nitrosylase NOS1
bNOS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NOS1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000089250.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7872 NOS1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
163731 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P29475

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4842

MalaCards human disease database

More...
MalaCardsi
NOS1

Open Targets

More...
OpenTargetsi
ENSG00000089250

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
930 Idiopathic achalasia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA252

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3568

Drug and drug target database

More...
DrugBanki
DB03461 2'-Monophosphoadenosine 5'-Diphosphoribose
DB01997 3-Bromo-7-Nitroindazole
DB03892 5-N-Allyl-Arginine
DB00997 Doxorubicin
DB03147 Flavin adenine dinucleotide
DB01942 Formic Acid
DB00155 L-Citrulline
DB02077 L-N(Omega)-Nitroarginine-(4r)-Amino-L-Proline Amide
DB09241 Methylene blue
DB02044 N-(3-(Aminomethyl)Benzyl)Acetamidine
DB03449 N-(4-(2-((3-Chlorophenylmethyl)Amino)Ethyl)Phenyl)-2-Thiophecarboxamidine
DB02727 N-Butyl-N'-Hydroxyguanidine
DB02143 N-Isopropyl-N'-Hydroxyguanidine
DB03144 N-Omega-Hydroxy-L-Arginine
DB02644 N-Omega-Propyl-L-Arginine
DB02027 N-{(4s)-4-Amino-5-[(2-Aminoethyl)Amino]Pentyl}-N'-Nitroguanidine
DB03710 N5-(1-Imino-3-Butenyl)-L-Ornithine
DB04223 Nitroarginine
DB06096 NXN-188
DB03247 Riboflavin Monophosphate
DB02991 S-Ethyl-N-[4-(Trifluoromethyl)Phenyl]Isothiourea
DB03707 S-Ethyl-N-Phenyl-Isothiourea

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1251

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NOS1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1709333

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001709211 – 1434Nitric oxide synthase, brainAdd BLAST1434

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei852PhosphoserineBy similarity1
Modified residuei862PhosphoserineBy similarity1
Modified residuei863PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated; mediated by STUB1/CHIP in the presence of Hsp70 and Hsp40 (in vitro).By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P29475

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P29475

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P29475

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P29475

PeptideAtlas

More...
PeptideAtlasi
P29475

PRoteomics IDEntifications database

More...
PRIDEi
P29475

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54578
54579 [P29475-2]
54580 [P29475-3]
54581 [P29475-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P29475

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P29475

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P29475

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is ubiquitously expressed: detected in skeletal muscle and brain, also in testis, lung and kidney, and at low levels in heart, adrenal gland and retina. Not detected in the platelets. Isoform 3 is expressed only in testis. Isoform 4 is detected in testis, skeletal muscle, lung, and kidney, at low levels in the brain, but not in the heart and adrenal gland.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000089250 Expressed in 115 organ(s), highest expression level in vastus lateralis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P29475 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P29475 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB002167
HPA058312

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with DLG4; the interaction possibly being prevented by the association between NOS1 and CAPON. Forms a ternary complex with CAPON and RASD1. Forms a ternary complex with CAPON and SYN1. Interacts with ZDHHC23. Interacts with NOSIP; which may impair its synaptic location (By similarity). Interacts with HTR4. Interacts with VAC14 (By similarity). Interacts with SLC6A4 (By similarity). Interacts (via N-terminal domain) with DLG4 (via N-terminal tandem pair of PDZ domains) (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
VAC14Q08AM65EBI-7164065,EBI-2107455

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110905, 15 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P29475

Database of interacting proteins

More...
DIPi
DIP-40999N

Protein interaction database and analysis system

More...
IntActi
P29475, 5 interactors

Molecular INTeraction database

More...
MINTi
P29475

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000477999

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P29475

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11434
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4D1NX-ray2.03A/B/C/D302-721[»]
4UCHX-ray2.20A/B302-723[»]
4UH5X-ray1.98A/B302-722[»]
4UH6X-ray1.98A/B302-722[»]
4V3UX-ray2.30A/B/C/D302-721[»]
5ADFX-ray1.97A/B302-722[»]
5ADGX-ray1.98A/B302-722[»]
5ADIX-ray2.20A/B302-722[»]
5FVUX-ray2.22A/B302-722[»]
5FVVX-ray2.05A/B302-722[»]
5FVWX-ray2.20A/B302-722[»]
5FVXX-ray2.30A/B302-722[»]
5UO1X-ray1.90A/B302-722[»]
5UO2X-ray1.95A/B302-722[»]
5UO3X-ray2.20A/B302-722[»]
5UO4X-ray2.00A/B302-722[»]
5UO5X-ray2.00A/B302-722[»]
5UO6X-ray1.96A/B302-722[»]
5UO7X-ray2.06A/B302-722[»]
5VUVX-ray1.98A/B302-722[»]
5VUWX-ray2.03A/B302-722[»]
5VUXX-ray2.30A/B302-722[»]
5VUYX-ray2.15A/B302-722[»]
5VUZX-ray1.97A/B302-722[»]
5VV0X-ray1.80A/B302-722[»]
5VV1X-ray1.95A/B302-722[»]
5VV2X-ray2.00A/B302-722[»]
5VV3X-ray2.18A/B302-722[»]
5VV4X-ray2.10A/B302-722[»]
5VV5X-ray2.15A/B302-722[»]
6AUYX-ray1.92A/B302-722[»]
6AUZX-ray2.00A/B302-722[»]
6AV0X-ray2.00A/B302-722[»]
6AV1X-ray2.45A/B302-722[»]
6AV2X-ray2.10A/B302-722[»]
6AV3X-ray1.95A/B302-722[»]
6AV4X-ray1.87A/B302-722[»]
6AV5X-ray1.90A/B302-722[»]
6CICX-ray1.75A/B302-722[»]
6CIDX-ray1.75A/B302-722[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P29475

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P29475

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini17 – 99PDZPROSITE-ProRule annotationAdd BLAST83
Domaini760 – 940Flavodoxin-likePROSITE-ProRule annotationAdd BLAST181
Domaini995 – 1242FAD-binding FR-typePROSITE-ProRule annotationAdd BLAST248

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 205Interaction with NOSIPBy similarityAdd BLAST205
Regioni163 – 245PIN (nNOS-inhibiting protein) bindingAdd BLAST83
Regioni730 – 750Calmodulin-bindingSequence analysisAdd BLAST21
Regioni755 – 774Tetrahydrobiopterin-bindingBy similarityAdd BLAST20

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PDZ domain in the N-terminal part of the neuronal isoform participates in protein-protein interaction, and is responsible for targeting nNos to synaptic membranes in muscles. Mediates interaction with VAC14 (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NOS family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1158 Eukaryota
COG0369 LUCA
COG4362 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159357

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000220884

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000159

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P29475

KEGG Orthology (KO)

More...
KOi
K13240

Identification of Orthologs from Complete Genome Data

More...
OMAi
HNRSRET

Database of Orthologous Groups

More...
OrthoDBi
90349at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P29475

TreeFam database of animal gene trees

More...
TreeFami
TF324410

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.990.10, 1 hit
3.40.50.360, 1 hit
3.40.50.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003097 CysJ-like_FAD-binding
IPR017927 FAD-bd_FR_type
IPR001094 Flavdoxin-like
IPR008254 Flavodoxin/NO_synth
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR029039 Flavoprotein-like_sf
IPR039261 FNR_nucleotide-bd
IPR023173 NADPH_Cyt_P450_Rdtase_alpha
IPR012144 NOS_euk
IPR004030 NOS_N
IPR036119 NOS_N_sf
IPR001433 OxRdtase_FAD/NAD-bd
IPR001478 PDZ
IPR036034 PDZ_sf
IPR017938 Riboflavin_synthase-like_b-brl

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00667 FAD_binding_1, 1 hit
PF00258 Flavodoxin_1, 1 hit
PF00175 NAD_binding_1, 1 hit
PF02898 NO_synthase, 1 hit
PF00595 PDZ, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000333 NOS, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00369 FLAVODOXIN
PR00371 FPNCR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit
SSF52218 SSF52218, 1 hit
SSF52343 SSF52343, 1 hit
SSF56512 SSF56512, 1 hit
SSF63380 SSF63380, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51384 FAD_FR, 1 hit
PS50902 FLAVODOXIN_LIKE, 1 hit
PS60001 NOS, 1 hit
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Isoform 3 is produced by different alternative splicing events implicating either the untranslated exons TEX1 (TN-NOS) or TEX1B (TN-NOSB) leading to a N-terminally truncated protein which possesses enzymatic activity comparable to that of isoform 1. The C-terminally truncated isoform 4 is produced by insertion of the TEX2 exon between exons 3 and 4 of isoform 1, leading to a frameshift and a premature stop codon.1 Publication

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P29475-1) [UniParc]FASTAAdd to basket
Also known as: N-NOS-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEDHMFGVQQ IQPNVISVRL FKRKVGGLGF LVKERVSKPP VIISDLIRGG
60 70 80 90 100
AAEQSGLIQA GDIILAVNGR PLVDLSYDSA LEVLRGIASE THVVLILRGP
110 120 130 140 150
EGFTTHLETT FTGDGTPKTI RVTQPLGPPT KAVDLSHQPP AGKEQPLAVD
160 170 180 190 200
GASGPGNGPQ HAYDDGQEAG SLPHANGLAP RPPGQDPAKK ATRVSLQGRG
210 220 230 240 250
ENNELLKEIE PVLSLLTSGS RGVKGGAPAK AEMKDMGIQV DRDLDGKSHK
260 270 280 290 300
PLPLGVENDR VFNDLWGKGN VPVVLNNPYS EKEQPPTSGK QSPTKNGSPS
310 320 330 340 350
KCPRFLKVKN WETEVVLTDT LHLKSTLETG CTEYICMGSI MHPSQHARRP
360 370 380 390 400
EDVRTKGQLF PLAKEFIDQY YSSIKRFGSK AHMERLEEVN KEIDTTSTYQ
410 420 430 440 450
LKDTELIYGA KHAWRNASRC VGRIQWSKLQ VFDARDCTTA HGMFNYICNH
460 470 480 490 500
VKYATNKGNL RSAITIFPQR TDGKHDFRVW NSQLIRYAGY KQPDGSTLGD
510 520 530 540 550
PANVQFTEIC IQQGWKPPRG RFDVLPLLLQ ANGNDPELFQ IPPELVLEVP
560 570 580 590 600
IRHPKFEWFK DLGLKWYGLP AVSNMLLEIG GLEFSACPFS GWYMGTEIGV
610 620 630 640 650
RDYCDNSRYN ILEEVAKKMN LDMRKTSSLW KDQALVEINI AVLYSFQSDK
660 670 680 690 700
VTIVDHHSAT ESFIKHMENE YRCRGGCPAD WVWIVPPMSG SITPVFHQEM
710 720 730 740 750
LNYRLTPSFE YQPDPWNTHV WKGTNGTPTK RRAIGFKKLA EAVKFSAKLM
760 770 780 790 800
GQAMAKRVKA TILYATETGK SQAYAKTLCE IFKHAFDAKV MSMEEYDIVH
810 820 830 840 850
LEHETLVLVV TSTFGNGDPP ENGEKFGCAL MEMRHPNSVQ EERKSYKVRF
860 870 880 890 900
NSVSSYSDSQ KSSGDGPDLR DNFESAGPLA NVRFSVFGLG SRAYPHFCAF
910 920 930 940 950
GHAVDTLLEE LGGERILKMR EGDELCGQEE AFRTWAKKVF KAACDVFCVG
960 970 980 990 1000
DDVNIEKANN SLISNDRSWK RNKFRLTFVA EAPELTQGLS NVHKKRVSAA
1010 1020 1030 1040 1050
RLLSRQNLQS PKSSRSTIFV RLHTNGSQEL QYQPGDHLGV FPGNHEDLVN
1060 1070 1080 1090 1100
ALIERLEDAP PVNQMVKVEL LEERNTALGV ISNWTDELRL PPCTIFQAFK
1110 1120 1130 1140 1150
YYLDITTPPT PLQLQQFASL ATSEKEKQRL LVLSKGLQEY EEWKWGKNPT
1160 1170 1180 1190 1200
IVEVLEEFPS IQMPATLLLT QLSLLQPRYY SISSSPDMYP DEVHLTVAIV
1210 1220 1230 1240 1250
SYRTRDGEGP IHHGVCSSWL NRIQADELVP CFVRGAPSFH LPRNPQVPCI
1260 1270 1280 1290 1300
LVGPGTGIAP FRSFWQQRQF DIQHKGMNPC PMVLVFGCRQ SKIDHIYREE
1310 1320 1330 1340 1350
TLQAKNKGVF RELYTAYSRE PDKPKKYVQD ILQEQLAESV YRALKEQGGH
1360 1370 1380 1390 1400
IYVCGDVTMA ADVLKAIQRI MTQQGKLSAE DAGVFISRMR DDNRYHEDIF
1410 1420 1430
GVTLRTYEVT NRLRSESIAF IEESKKDTDE VFSS
Length:1,434
Mass (Da):160,970
Last modified:October 1, 1996 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i99235793B953BF37
GO
Isoform 2 (identifier: P29475-2) [UniParc]FASTAAdd to basket
Also known as: N-NOS-2

The sequence of this isoform differs from the canonical sequence as follows:
     509-613: Missing.

Show »
Length:1,329
Mass (Da):148,919
Checksum:iDF791B80FDB12302
GO
Isoform 3 (identifier: P29475-3) [UniParc]FASTAAdd to basket
Also known as: TN-NOS, TN-NOSB

The sequence of this isoform differs from the canonical sequence as follows:
     1-336: Missing.

Show »
Length:1,098
Mass (Da):125,113
Checksum:iA1CD5C5012436233
GO
Isoform 4 (identifier: P29475-4) [UniParc]FASTAAdd to basket
Also known as: TEX2-insertion

The sequence of this isoform differs from the canonical sequence as follows:
     285-407: PPTSGKQSPT...TYQLKDTELI → MRKLRITEGF...PKPTWKGWKR
     408-1434: Missing.

Show »
Length:407
Mass (Da):43,838
Checksum:i7E9420C658EFACD2
GO
Isoform 5 (identifier: P29475-5) [UniParc]FASTAAdd to basket
Also known as: nNOSmu

The sequence of this isoform differs from the canonical sequence as follows:
     844-844: K → KYPEPLRFFPRKGPPLPNGDTEVHGLAAARDSQHR

Show »
Length:1,468
Mass (Da):164,779
Checksum:i95906AC90699A0E2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J5P6C9J5P6_HUMAN
Nitric oxide synthase
NOS1
1,433Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti131K → E in AAB49040 (PubMed:8879752).Curated1
Sequence conflicti178 – 184LAPRPPG → WPQAPR (PubMed:7678401).Curated7
Sequence conflicti178 – 184LAPRPPG → WPQAPR (PubMed:8879752).Curated7
Sequence conflicti492 – 493QP → HR in AAA36376 (PubMed:7678401).Curated2
Sequence conflicti549V → L in AAA36376 (PubMed:7678401).Curated1
Sequence conflicti563G → A in AAA36376 (PubMed:7678401).Curated1
Sequence conflicti1407Y → I in AAA36376 (PubMed:7678401).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_018948228P → S1 PublicationCorresponds to variant dbSNP:rs9658279Ensembl.1
Natural variantiVAR_018949394D → A1 PublicationCorresponds to variant dbSNP:rs9658356Ensembl.1
Natural variantiVAR_018950725N → D1 PublicationCorresponds to variant dbSNP:rs9658403Ensembl.1
Natural variantiVAR_018951864G → D1 PublicationCorresponds to variant dbSNP:rs9658445Ensembl.1
Natural variantiVAR_0189521064Q → R1 PublicationCorresponds to variant dbSNP:rs9658482Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0035711 – 336Missing in isoform 3. CuratedAdd BLAST336
Alternative sequenceiVSP_003572285 – 407PPTSG…DTELI → MRKLRITEGFGVQRGSHNHP PPQENSPPQRMAAPPSVHAS SRSRTGRLRWFSLTPSTLRA HWKRDALSTSAWAPSCILLS MQGGLKTSAQKDSSSLSPKS LLINTIHQLKDLAPKPTWKG WKR in isoform 4. CuratedAdd BLAST123
Alternative sequenceiVSP_003573408 – 1434Missing in isoform 4. CuratedAdd BLAST1027
Alternative sequenceiVSP_003574509 – 613Missing in isoform 2. 2 PublicationsAdd BLAST105
Alternative sequenceiVSP_044916844K → KYPEPLRFFPRKGPPLPNGD TEVHGLAAARDSQHR in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U17327 mRNA Translation: AAA62405.1
U17326
, U17299, U17300, U17301, U17302, U17303, U17304, U17305, U17307, U17308, U17309, U17310, U17311, U17312, U17313, U17314, U17315, U17316, U17317, U17318, U17319, U17320, U17321, U17322, U17323, U17324, U17325 Genomic DNA Translation: AAB60654.1 Sequence problems.
D16408 mRNA Translation: BAA03895.1
L02881 mRNA Translation: AAA36376.1
U31466 mRNA Translation: AAB49040.1
U66362 Genomic DNA No translation available.
AY445095 Genomic DNA Translation: AAR07069.1
AC026364 Genomic DNA No translation available.
AC068799 Genomic DNA No translation available.
AC073864 Genomic DNA No translation available.
AJ004918 mRNA Translation: CAA06218.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41842.1 [P29475-1]
CCDS55890.1 [P29475-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
G01946

NCBI Reference Sequences

More...
RefSeqi
NP_000611.1, NM_000620.4 [P29475-1]
NP_001191142.1, NM_001204213.1 [P29475-3]
NP_001191143.1, NM_001204214.1 [P29475-3]
NP_001191147.1, NM_001204218.1 [P29475-5]
XP_011536700.1, XM_011538398.2
XP_016874834.1, XM_017019345.1
XP_016874835.1, XM_017019346.1
XP_016874836.1, XM_017019347.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.654410
Hs.684465
Hs.684466
Hs.684467
Hs.735734

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317775; ENSP00000320758; ENSG00000089250 [P29475-1]
ENST00000338101; ENSP00000337459; ENSG00000089250 [P29475-5]
ENST00000618760; ENSP00000477999; ENSG00000089250 [P29475-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4842

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4842

UCSC genome browser

More...
UCSCi
uc001twm.3 human [P29475-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs
Wikipedia

Nitric oxide synthase entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U17327 mRNA Translation: AAA62405.1
U17326
, U17299, U17300, U17301, U17302, U17303, U17304, U17305, U17307, U17308, U17309, U17310, U17311, U17312, U17313, U17314, U17315, U17316, U17317, U17318, U17319, U17320, U17321, U17322, U17323, U17324, U17325 Genomic DNA Translation: AAB60654.1 Sequence problems.
D16408 mRNA Translation: BAA03895.1
L02881 mRNA Translation: AAA36376.1
U31466 mRNA Translation: AAB49040.1
U66362 Genomic DNA No translation available.
AY445095 Genomic DNA Translation: AAR07069.1
AC026364 Genomic DNA No translation available.
AC068799 Genomic DNA No translation available.
AC073864 Genomic DNA No translation available.
AJ004918 mRNA Translation: CAA06218.1
CCDSiCCDS41842.1 [P29475-1]
CCDS55890.1 [P29475-5]
PIRiG01946
RefSeqiNP_000611.1, NM_000620.4 [P29475-1]
NP_001191142.1, NM_001204213.1 [P29475-3]
NP_001191143.1, NM_001204214.1 [P29475-3]
NP_001191147.1, NM_001204218.1 [P29475-5]
XP_011536700.1, XM_011538398.2
XP_016874834.1, XM_017019345.1
XP_016874835.1, XM_017019346.1
XP_016874836.1, XM_017019347.1
UniGeneiHs.654410
Hs.684465
Hs.684466
Hs.684467
Hs.735734

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4D1NX-ray2.03A/B/C/D302-721[»]
4UCHX-ray2.20A/B302-723[»]
4UH5X-ray1.98A/B302-722[»]
4UH6X-ray1.98A/B302-722[»]
4V3UX-ray2.30A/B/C/D302-721[»]
5ADFX-ray1.97A/B302-722[»]
5ADGX-ray1.98A/B302-722[»]
5ADIX-ray2.20A/B302-722[»]
5FVUX-ray2.22A/B302-722[»]
5FVVX-ray2.05A/B302-722[»]
5FVWX-ray2.20A/B302-722[»]
5FVXX-ray2.30A/B302-722[»]
5UO1X-ray1.90A/B302-722[»]
5UO2X-ray1.95A/B302-722[»]
5UO3X-ray2.20A/B302-722[»]
5UO4X-ray2.00A/B302-722[»]
5UO5X-ray2.00A/B302-722[»]
5UO6X-ray1.96A/B302-722[»]
5UO7X-ray2.06A/B302-722[»]
5VUVX-ray1.98A/B302-722[»]
5VUWX-ray2.03A/B302-722[»]
5VUXX-ray2.30A/B302-722[»]
5VUYX-ray2.15A/B302-722[»]
5VUZX-ray1.97A/B302-722[»]
5VV0X-ray1.80A/B302-722[»]
5VV1X-ray1.95A/B302-722[»]
5VV2X-ray2.00A/B302-722[»]
5VV3X-ray2.18A/B302-722[»]
5VV4X-ray2.10A/B302-722[»]
5VV5X-ray2.15A/B302-722[»]
6AUYX-ray1.92A/B302-722[»]
6AUZX-ray2.00A/B302-722[»]
6AV0X-ray2.00A/B302-722[»]
6AV1X-ray2.45A/B302-722[»]
6AV2X-ray2.10A/B302-722[»]
6AV3X-ray1.95A/B302-722[»]
6AV4X-ray1.87A/B302-722[»]
6AV5X-ray1.90A/B302-722[»]
6CICX-ray1.75A/B302-722[»]
6CIDX-ray1.75A/B302-722[»]
ProteinModelPortaliP29475
SMRiP29475
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110905, 15 interactors
CORUMiP29475
DIPiDIP-40999N
IntActiP29475, 5 interactors
MINTiP29475
STRINGi9606.ENSP00000477999

Chemistry databases

BindingDBiP29475
ChEMBLiCHEMBL3568
DrugBankiDB03461 2'-Monophosphoadenosine 5'-Diphosphoribose
DB01997 3-Bromo-7-Nitroindazole
DB03892 5-N-Allyl-Arginine
DB00997 Doxorubicin
DB03147 Flavin adenine dinucleotide
DB01942 Formic Acid
DB00155 L-Citrulline
DB02077 L-N(Omega)-Nitroarginine-(4r)-Amino-L-Proline Amide
DB09241 Methylene blue
DB02044 N-(3-(Aminomethyl)Benzyl)Acetamidine
DB03449 N-(4-(2-((3-Chlorophenylmethyl)Amino)Ethyl)Phenyl)-2-Thiophecarboxamidine
DB02727 N-Butyl-N'-Hydroxyguanidine
DB02143 N-Isopropyl-N'-Hydroxyguanidine
DB03144 N-Omega-Hydroxy-L-Arginine
DB02644 N-Omega-Propyl-L-Arginine
DB02027 N-{(4s)-4-Amino-5-[(2-Aminoethyl)Amino]Pentyl}-N'-Nitroguanidine
DB03710 N5-(1-Imino-3-Butenyl)-L-Ornithine
DB04223 Nitroarginine
DB06096 NXN-188
DB03247 Riboflavin Monophosphate
DB02991 S-Ethyl-N-[4-(Trifluoromethyl)Phenyl]Isothiourea
DB03707 S-Ethyl-N-Phenyl-Isothiourea
GuidetoPHARMACOLOGYi1251

PTM databases

iPTMnetiP29475
PhosphoSitePlusiP29475

Polymorphism and mutation databases

BioMutaiNOS1
DMDMi1709333

Proteomic databases

EPDiP29475
jPOSTiP29475
MaxQBiP29475
PaxDbiP29475
PeptideAtlasiP29475
PRIDEiP29475
ProteomicsDBi54578
54579 [P29475-2]
54580 [P29475-3]
54581 [P29475-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4842
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317775; ENSP00000320758; ENSG00000089250 [P29475-1]
ENST00000338101; ENSP00000337459; ENSG00000089250 [P29475-5]
ENST00000618760; ENSP00000477999; ENSG00000089250 [P29475-5]
GeneIDi4842
KEGGihsa:4842
UCSCiuc001twm.3 human [P29475-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4842
DisGeNETi4842
EuPathDBiHostDB:ENSG00000089250.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NOS1
HGNCiHGNC:7872 NOS1
HPAiCAB002167
HPA058312
MalaCardsiNOS1
MIMi163731 gene
neXtProtiNX_P29475
OpenTargetsiENSG00000089250
Orphaneti930 Idiopathic achalasia
PharmGKBiPA252

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1158 Eukaryota
COG0369 LUCA
COG4362 LUCA
GeneTreeiENSGT00940000159357
HOGENOMiHOG000220884
HOVERGENiHBG000159
InParanoidiP29475
KOiK13240
OMAiHNRSRET
OrthoDBi90349at2759
PhylomeDBiP29475
TreeFamiTF324410

Enzyme and pathway databases

BioCyciMetaCyc:HS01647-MONOMER
BRENDAi1.14.13.39 2681
ReactomeiR-HSA-1222556 ROS, RNS production in phagocytes
R-HSA-392154 Nitric oxide stimulates guanylate cyclase
R-HSA-5578775 Ion homeostasis
SIGNORiP29475

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NOS1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NOS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4842
PMAP-CutDBiP29475

Protein Ontology

More...
PROi
PR:P29475

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000089250 Expressed in 115 organ(s), highest expression level in vastus lateralis
ExpressionAtlasiP29475 baseline and differential
GenevisibleiP29475 HS

Family and domain databases

Gene3Di1.20.990.10, 1 hit
3.40.50.360, 1 hit
3.40.50.80, 1 hit
InterProiView protein in InterPro
IPR003097 CysJ-like_FAD-binding
IPR017927 FAD-bd_FR_type
IPR001094 Flavdoxin-like
IPR008254 Flavodoxin/NO_synth
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR029039 Flavoprotein-like_sf
IPR039261 FNR_nucleotide-bd
IPR023173 NADPH_Cyt_P450_Rdtase_alpha
IPR012144 NOS_euk
IPR004030 NOS_N
IPR036119 NOS_N_sf
IPR001433 OxRdtase_FAD/NAD-bd
IPR001478 PDZ
IPR036034 PDZ_sf
IPR017938 Riboflavin_synthase-like_b-brl
PfamiView protein in Pfam
PF00667 FAD_binding_1, 1 hit
PF00258 Flavodoxin_1, 1 hit
PF00175 NAD_binding_1, 1 hit
PF02898 NO_synthase, 1 hit
PF00595 PDZ, 1 hit
PIRSFiPIRSF000333 NOS, 1 hit
PRINTSiPR00369 FLAVODOXIN
PR00371 FPNCR
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
SSF52218 SSF52218, 1 hit
SSF52343 SSF52343, 1 hit
SSF56512 SSF56512, 1 hit
SSF63380 SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384 FAD_FR, 1 hit
PS50902 FLAVODOXIN_LIKE, 1 hit
PS60001 NOS, 1 hit
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNOS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P29475
Secondary accession number(s): E9PH30, O75713
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 1, 1996
Last modified: April 10, 2019
This is version 212 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again