Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nitric oxide synthase, endothelial

Gene

NOS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
Isoform eNOS13C: Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Stimulated by calcium/calmodulin. Inhibited by NOSIP and NOSTRIN.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi94Zinc1
Metal bindingi99Zinc1
Metal bindingi184Iron (heme axial ligand)1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi649 – 680FMNPROSITE-ProRule annotationAdd BLAST32
Nucleotide bindingi793 – 804FADBy similarityAdd BLAST12
Nucleotide bindingi935 – 945FADBy similarityAdd BLAST11
Nucleotide bindingi1010 – 1028NADPBy similarityAdd BLAST19
Nucleotide bindingi1108 – 1123NADPBy similarityAdd BLAST16

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin monomer binding Source: BHF-UCL
  • arginine binding Source: BHF-UCL
  • cadmium ion binding Source: BHF-UCL
  • calmodulin binding Source: UniProtKB-KW
  • flavin adenine dinucleotide binding Source: GO_Central
  • FMN binding Source: GO_Central
  • heme binding Source: BHF-UCL
  • NADP binding Source: BHF-UCL
  • NADPH-hemoprotein reductase activity Source: GO_Central
  • nitric-oxide synthase activity Source: BHF-UCL
  • oxidoreductase activity Source: GO_Central
  • scaffold protein binding Source: Ensembl
  • tetrahydrobiopterin binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Oxidoreductase
LigandCalcium, FAD, Flavoprotein, FMN, Heme, Iron, Metal-binding, NADP, Zinc

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS09149-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.14.13.39 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1222556 ROS, RNS production in phagocytes
R-HSA-1474151 Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation
R-HSA-203615 eNOS activation
R-HSA-203641 NOSTRIN mediated eNOS trafficking
R-HSA-203754 NOSIP mediated eNOS trafficking
R-HSA-392154 Nitric oxide stimulates guanylate cyclase
R-HSA-5218920 VEGFR2 mediated vascular permeability

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P29474

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P29474

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nitric oxide synthase, endothelial (EC:1.14.13.39)
Alternative name(s):
Constitutive NOS
Short name:
cNOS
EC-NOS
Endothelial NOS
Short name:
eNOS
NOS type III
Short name:
NOSIII
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NOS3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164867.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7876 NOS3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
163729 gene+phenotype

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P29474

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Variation Asp-298 in NOS3 may be associated with susceptibility to coronary spasm.2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi114S → A: Reduced nitrite (NO) production. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
4846

MalaCards human disease database

More...
MalaCardsi
NOS3
MIMi163729 gene+phenotype

Open Targets

More...
OpenTargetsi
ENSG00000164867

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA254

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4803

Drug and drug target database

More...
DrugBanki
DB02335 2-Aminothiazoline
DB01997 3-Bromo-7-Nitroindazole
DB04534 5-Nitroindazole
DB03100 6-Nitroindazole
DB02207 7-Nitroindazole
DB03065 7-Nitroindazole-2-Carboxamidine
DB05676 Apremilast
DB00997 Doxorubicin
DB07388 ETHYL 4-[(4-METHYLPYRIDIN-2-YL)AMINO]PIPERIDINE-1-CARBOXYLATE
DB02234 Ethylisothiourea
DB02994 Hydroxydimethylarsine Oxide
DB01833 L-2-Amino-4-(Guanidinooxy)Butyric Acid
DB00125 L-Arginine
DB00155 L-Citrulline
DB03974 L-Homoarginine
DB02077 L-N(Omega)-Nitroarginine-(4r)-Amino-L-Proline Amide
DB01110 Miconazole
DB02044 N-(3-(Aminomethyl)Benzyl)Acetamidine
DB04559 N-(Chlorophenyl)-N'-Hydroxyguanidine
DB03144 N-Omega-Hydroxy-L-Arginine
DB02027 N-{(4s)-4-Amino-5-[(2-Aminoethyl)Amino]Pentyl}-N'-Nitroguanidine
DB03305 N5-Iminoethyl-L-Ornithine
DB04223 Nitroarginine
DB03963 S-(Dimethylarsenic)Cysteine
DB03707 S-Ethyl-N-Phenyl-Isothiourea
DB04018 S-Isopropyl-Isothiourea
DB00360 Sapropterin
DB02589 Se-Ethyl-Isoselenourea

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1249

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NOS3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
266648

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001709432 – 1203Nitric oxide synthase, endothelialAdd BLAST1202

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1
Lipidationi15S-palmitoyl cysteineBy similarity1
Lipidationi26S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei33PhosphothreonineCombined sources1
Modified residuei114Phosphoserine; by CDK51 Publication1
Modified residuei495Phosphothreonine; by AMPK1 Publication1
Modified residuei615PhosphoserineBy similarity1
Modified residuei633PhosphoserineCombined sources1
Modified residuei638PhosphoserineCombined sources1
Modified residuei836PhosphoserineCombined sources1
Modified residuei1175PhosphothreonineBy similarity1
Modified residuei1177Phosphoserine; by AMPKCombined sources1 Publication1
Modified residuei1179PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by AMPK at Ser-1177 in the presence of Ca2+-calmodulin (CaM) activates activity. In absence of Ca2+-calmodulin, AMPK also phosphorylates Thr-495, resulting in inhibition of activity (By similarity). Phosphorylation of Ser-114 by CDK5 reduces activity.By similarity2 Publications

Keywords - PTMi

Lipoprotein, Myristate, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P29474

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P29474

PeptideAtlas

More...
PeptideAtlasi
P29474

PRoteomics IDEntifications database

More...
PRIDEi
P29474

ProteomicsDB human proteome resource

More...
ProteomicsDBi
54576
54577 [P29474-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P29474

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P29474

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P29474

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Platelets, placenta, liver and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164867 Expressed in 96 organ(s), highest expression level in spleen

CleanEx database of gene expression profiles

More...
CleanExi
HS_NOS3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P29474 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P29474 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB002168

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts with NOSIP and NOSTRIN. Interacts with HSP90AB1 (PubMed:23585225).3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110909, 46 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P29474

Database of interacting proteins

More...
DIPi
DIP-38479N

Protein interaction database and analysis system

More...
IntActi
P29474, 39 interactors

Molecular INTeraction database

More...
MINTi
P29474

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000297494

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11203
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P29474

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P29474

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P29474

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini520 – 703Flavodoxin-likePROSITE-ProRule annotationAdd BLAST184
Domaini756 – 1002FAD-binding FR-typePROSITE-ProRule annotationAdd BLAST247

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni98 – 486Interaction with NOSIP1 PublicationAdd BLAST389
Regioni491 – 510Calmodulin-bindingSequence analysisAdd BLAST20

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NOS family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1158 Eukaryota
COG0369 LUCA
COG4362 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161389

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111088

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG079617

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P29474

KEGG Orthology (KO)

More...
KOi
K13242

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQASCET

Database of Orthologous Groups

More...
OrthoDBi
EOG091G10Z0

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P29474

TreeFam database of animal gene trees

More...
TreeFami
TF324410

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.990.10, 1 hit
3.40.50.360, 1 hit
3.40.50.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003097 CysJ-like_FAD-binding
IPR017927 FAD-bd_FR_type
IPR001094 Flavdoxin-like
IPR008254 Flavodoxin/NO_synth
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR029039 Flavoprotein-like_sf
IPR039261 FNR_nucleotide-bd
IPR023173 NADPH_Cyt_P450_Rdtase_alpha
IPR012144 NOS_euk
IPR004030 NOS_N
IPR036119 NOS_N_sf
IPR001433 OxRdtase_FAD/NAD-bd
IPR017938 Riboflavin_synthase-like_b-brl

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00667 FAD_binding_1, 1 hit
PF00258 Flavodoxin_1, 1 hit
PF00175 NAD_binding_1, 1 hit
PF02898 NO_synthase, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000333 NOS, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00369 FLAVODOXIN
PR00371 FPNCR

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52218 SSF52218, 1 hit
SSF52343 SSF52343, 1 hit
SSF56512 SSF56512, 1 hit
SSF63380 SSF63380, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51384 FAD_FR, 1 hit
PS50902 FLAVODOXIN_LIKE, 1 hit
PS60001 NOS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P29474-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNLKSVAQE PGPPCGLGLG LGLGLCGKQG PATPAPEPSR APASLLPPAP
60 70 80 90 100
EHSPPSSPLT QPPEGPKFPR VKNWEVGSIT YDTLSAQAQQ DGPCTPRRCL
110 120 130 140 150
GSLVFPRKLQ GRPSPGPPAP EQLLSQARDF INQYYSSIKR SGSQAHEQRL
160 170 180 190 200
QEVEAEVAAT GTYQLRESEL VFGAKQAWRN APRCVGRIQW GKLQVFDARD
210 220 230 240 250
CRSAQEMFTY ICNHIKYATN RGNLRSAITV FPQRCPGRGD FRIWNSQLVR
260 270 280 290 300
YAGYRQQDGS VRGDPANVEI TELCIQHGWT PGNGRFDVLP LLLQAPDDPP
310 320 330 340 350
ELFLLPPELV LEVPLEHPTL EWFAALGLRW YALPAVSNML LEIGGLEFPA
360 370 380 390 400
APFSGWYMST EIGTRNLCDP HRYNILEDVA VCMDLDTRTT SSLWKDKAAV
410 420 430 440 450
EINVAVLHSY QLAKVTIVDH HAATASFMKH LENEQKARGG CPADWAWIVP
460 470 480 490 500
PISGSLTPVF HQEMVNYFLS PAFRYQPDPW KGSAAKGTGI TRKKTFKEVA
510 520 530 540 550
NAVKISASLM GTVMAKRVKA TILYGSETGR AQSYAQQLGR LFRKAFDPRV
560 570 580 590 600
LCMDEYDVVS LEHETLVLVV TSTFGNGDPP ENGESFAAAL MEMSGPYNSS
610 620 630 640 650
PRPEQHKSYK IRFNSISCSD PLVSSWRRKR KESSNTDSAG ALGTLRFCVF
660 670 680 690 700
GLGSRAYPHF CAFARAVDTR LEELGGERLL QLGQGDELCG QEEAFRGWAQ
710 720 730 740 750
AAFQAACETF CVGEDAKAAA RDIFSPKRSW KRQRYRLSAQ AEGLQLLPGL
760 770 780 790 800
IHVHRRKMFQ ATIRSVENLQ SSKSTRATIL VRLDTGGQEG LQYQPGDHIG
810 820 830 840 850
VCPPNRPGLV EALLSRVEDP PAPTEPVAVE QLEKGSPGGP PPGWVRDPRL
860 870 880 890 900
PPCTLRQALT FFLDITSPPS PQLLRLLSTL AEEPREQQEL EALSQDPRRY
910 920 930 940 950
EEWKWFRCPT LLEVLEQFPS VALPAPLLLT QLPLLQPRYY SVSSAPSTHP
960 970 980 990 1000
GEIHLTVAVL AYRTQDGLGP LHYGVCSTWL SQLKPGDPVP CFIRGAPSFR
1010 1020 1030 1040 1050
LPPDPSLPCI LVGPGTGIAP FRGFWQERLH DIESKGLQPT PMTLVFGCRC
1060 1070 1080 1090 1100
SQLDHLYRDE VQNAQQRGVF GRVLTAFSRE PDNPKTYVQD ILRTELAAEV
1110 1120 1130 1140 1150
HRVLCLERGH MFVCGDVTMA TNVLQTVQRI LATEGDMELD EAGDVIGVLR
1160 1170 1180 1190 1200
DQQRYHEDIF GLTLRTQEVT SRIRTQSFSL QERQLRGAVP WAFDPPGSDT

NSP
Length:1,203
Mass (Da):133,275
Last modified:March 28, 2018 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB761A6D40B1A5649
GO
Isoform eNOS13C (identifier: P29474-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     584-625: ESFAAALMEM...ISCSDPLVSS → EGLTLWPRLE...VGTTGACHDA
     626-1203: Missing.

Note: Lacks eNOS activity.
Show »
Length:629
Mass (Da):68,965
Checksum:iA40D0DFCEB1774E3
GO
Isoform eNOS13B (identifier: P29474-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     585-614: SFAAALMEMSGPYNSSPRPEQHKSYKIRFN → RWGFAMLPRLVSNSWVQAIHLPRPPKVLRL
     615-1203: Missing.

Show »
Length:614
Mass (Da):67,862
Checksum:iCE895E896E61722E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ESA7E7ESA7_HUMAN
Nitric oxide synthase, endothelial
NOS3
997Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTA6A0A0A0MTA6_HUMAN
Nitric oxide synthase, endothelial
NOS3
614Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4V4H7C4V4_HUMAN
Nitric oxide synthase, endothelial
NOS3
306Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53S → R in AAA36373 (PubMed:7514568).Curated1
Sequence conflicti168S → G in BAG37648 (PubMed:14702039).Curated1
Sequence conflicti414K → R in BAF85617 (PubMed:14702039).Curated1
Sequence conflicti489G → S in AAD14336 (PubMed:7475956).Curated1
Sequence conflicti567V → W in CAA53950 (PubMed:7509596).Curated1
Sequence conflicti1150R → RQ in BAA05652 (PubMed:7519987).Curated1
Sequence conflicti1194D → E in CAA53950 (PubMed:7509596).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031218112R → Q1 PublicationCorresponds to variant dbSNP:rs3918166Ensembl.1
Natural variantiVAR_008037298D → E16 PublicationsCorresponds to variant dbSNP:rs1799983EnsemblClinVar.1
Natural variantiVAR_036303474R → C Found in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs145805216Ensembl.1
Natural variantiVAR_036304602R → Q Found in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs145168353Ensembl.1
Natural variantiVAR_061377665R → H. Corresponds to variant dbSNP:rs7792133Ensembl.1
Natural variantiVAR_031219827V → M1 PublicationCorresponds to variant dbSNP:rs3918232Ensembl.1
Natural variantiVAR_031220885R → M1 PublicationCorresponds to variant dbSNP:rs3918201Ensembl.1
Natural variantiVAR_031221982Q → L1 PublicationCorresponds to variant dbSNP:rs3918234Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042625584 – 625ESFAA…PLVSS → EGLTLWPRLECSSTITAHCS LNLLDSSNPPTSTSQVVGTT GACHDA in isoform eNOS13C. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_045495585 – 614SFAAA…KIRFN → RWGFAMLPRLVSNSWVQAIH LPRPPKVLRL in isoform eNOS13B. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_045496615 – 1203Missing in isoform eNOS13B. 1 PublicationAdd BLAST589
Alternative sequenceiVSP_042626626 – 1203Missing in isoform eNOS13C. 1 PublicationAdd BLAST578

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M93718 mRNA Translation: AAA36364.1
M95296 mRNA Translation: AAA36372.1
L10709
, L10693, L10694, L10695, L10696, L10697, L10698, L10699, L10700, L10701, L10702, L10703, L10704, L10705, L10706, L10707, L10708 Genomic DNA Translation: AAA36365.1
X76303
, X76304, X76305, X76306, X76307, X76308, X76309, X76310, X76311, X76312, X76313, X76314, X76315, X76316 Genomic DNA Translation: CAA53950.1
D26607 Genomic DNA Translation: BAA05652.1
DQ256130 mRNA Translation: ABB79839.1
DQ256131 mRNA Translation: ABB79840.1
L26914 Genomic DNA Translation: AAA36374.1
AF400594 mRNA Translation: AAK83389.1
AK292928 mRNA Translation: BAF85617.1
AK315213 mRNA Translation: BAG37648.1
AK223636 mRNA Translation: BAD97356.1
AF519768 Genomic DNA Translation: AAM74944.1
EU332855 Genomic DNA Translation: ABY87544.1
AC010973 Genomic DNA No translation available.
CH471173 Genomic DNA Translation: EAW54069.1
BC063294 mRNA Translation: AAH63294.1
BC069465 mRNA Translation: AAH69465.1
L23210 Genomic DNA Translation: AAA36373.1
S80791 mRNA Translation: AAD14336.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS55182.1 [P29474-2]
CCDS55183.1 [P29474-3]
CCDS5912.1 [P29474-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A47501

NCBI Reference Sequences

More...
RefSeqi
NP_000594.2, NM_000603.4 [P29474-1]
NP_001153581.1, NM_001160109.1
NP_001153582.1, NM_001160110.1 [P29474-3]
NP_001153583.1, NM_001160111.1 [P29474-2]
XP_016867721.1, XM_017012232.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.647092

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297494; ENSP00000297494; ENSG00000164867 [P29474-1]
ENST00000467517; ENSP00000420551; ENSG00000164867 [P29474-3]
ENST00000484524; ENSP00000420215; ENSG00000164867 [P29474-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4846

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4846

UCSC genome browser

More...
UCSCi
uc003wif.4 human [P29474-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Nitric oxide synthase entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M93718 mRNA Translation: AAA36364.1
M95296 mRNA Translation: AAA36372.1
L10709
, L10693, L10694, L10695, L10696, L10697, L10698, L10699, L10700, L10701, L10702, L10703, L10704, L10705, L10706, L10707, L10708 Genomic DNA Translation: AAA36365.1
X76303
, X76304, X76305, X76306, X76307, X76308, X76309, X76310, X76311, X76312, X76313, X76314, X76315, X76316 Genomic DNA Translation: CAA53950.1
D26607 Genomic DNA Translation: BAA05652.1
DQ256130 mRNA Translation: ABB79839.1
DQ256131 mRNA Translation: ABB79840.1
L26914 Genomic DNA Translation: AAA36374.1
AF400594 mRNA Translation: AAK83389.1
AK292928 mRNA Translation: BAF85617.1
AK315213 mRNA Translation: BAG37648.1
AK223636 mRNA Translation: BAD97356.1
AF519768 Genomic DNA Translation: AAM74944.1
EU332855 Genomic DNA Translation: ABY87544.1
AC010973 Genomic DNA No translation available.
CH471173 Genomic DNA Translation: EAW54069.1
BC063294 mRNA Translation: AAH63294.1
BC069465 mRNA Translation: AAH69465.1
L23210 Genomic DNA Translation: AAA36373.1
S80791 mRNA Translation: AAD14336.1
CCDSiCCDS55182.1 [P29474-2]
CCDS55183.1 [P29474-3]
CCDS5912.1 [P29474-1]
PIRiA47501
RefSeqiNP_000594.2, NM_000603.4 [P29474-1]
NP_001153581.1, NM_001160109.1
NP_001153582.1, NM_001160110.1 [P29474-3]
NP_001153583.1, NM_001160111.1 [P29474-2]
XP_016867721.1, XM_017012232.1
UniGeneiHs.647092

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1M9JX-ray2.43A/B67-481[»]
1M9KX-ray2.01A/B67-481[»]
1M9MX-ray1.96A/B67-481[»]
1M9QX-ray2.01A/B67-481[»]
1M9RX-ray2.56A/B67-481[»]
1NIWX-ray2.05B/D/F/H492-511[»]
2LL7NMR-B493-509[»]
2MG5NMR-B495-510[»]
2N8JNMR-B491-512[»]
3EAHX-ray2.44A/B66-492[»]
3NOSX-ray2.40A/B66-492[»]
4D1OX-ray1.82A/B41-480[»]
4D1PX-ray1.73A/B41-480[»]
5UO8X-ray2.18A/B/C/D41-480[»]
5UO9X-ray2.19A/B/C/D41-480[»]
5UOAX-ray2.20A/B41-480[»]
5UOBX-ray2.29A/B/C/D41-480[»]
5UOCX-ray2.20A/B/C/D41-480[»]
5VVBX-ray2.15A/B/C/D41-480[»]
5VVCX-ray2.40A/B/C/D41-480[»]
5VVDX-ray2.25A/B/C/D41-480[»]
5XOFX-ray1.96O/P/Q/R30-36[»]
6AV6X-ray2.08A/B/C/D41-480[»]
6AV7X-ray1.92A/B/C/D41-480[»]
ProteinModelPortaliP29474
SMRiP29474
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110909, 46 interactors
CORUMiP29474
DIPiDIP-38479N
IntActiP29474, 39 interactors
MINTiP29474
STRINGi9606.ENSP00000297494

Chemistry databases

ChEMBLiCHEMBL4803
DrugBankiDB02335 2-Aminothiazoline
DB01997 3-Bromo-7-Nitroindazole
DB04534 5-Nitroindazole
DB03100 6-Nitroindazole
DB02207 7-Nitroindazole
DB03065 7-Nitroindazole-2-Carboxamidine
DB05676 Apremilast
DB00997 Doxorubicin
DB07388 ETHYL 4-[(4-METHYLPYRIDIN-2-YL)AMINO]PIPERIDINE-1-CARBOXYLATE
DB02234 Ethylisothiourea
DB02994 Hydroxydimethylarsine Oxide
DB01833 L-2-Amino-4-(Guanidinooxy)Butyric Acid
DB00125 L-Arginine
DB00155 L-Citrulline
DB03974 L-Homoarginine
DB02077 L-N(Omega)-Nitroarginine-(4r)-Amino-L-Proline Amide
DB01110 Miconazole
DB02044 N-(3-(Aminomethyl)Benzyl)Acetamidine
DB04559 N-(Chlorophenyl)-N'-Hydroxyguanidine
DB03144 N-Omega-Hydroxy-L-Arginine
DB02027 N-{(4s)-4-Amino-5-[(2-Aminoethyl)Amino]Pentyl}-N'-Nitroguanidine
DB03305 N5-Iminoethyl-L-Ornithine
DB04223 Nitroarginine
DB03963 S-(Dimethylarsenic)Cysteine
DB03707 S-Ethyl-N-Phenyl-Isothiourea
DB04018 S-Isopropyl-Isothiourea
DB00360 Sapropterin
DB02589 Se-Ethyl-Isoselenourea
GuidetoPHARMACOLOGYi1249

PTM databases

iPTMnetiP29474
PhosphoSitePlusiP29474
SwissPalmiP29474

Polymorphism and mutation databases

BioMutaiNOS3
DMDMi266648

Proteomic databases

EPDiP29474
PaxDbiP29474
PeptideAtlasiP29474
PRIDEiP29474
ProteomicsDBi54576
54577 [P29474-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4846
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297494; ENSP00000297494; ENSG00000164867 [P29474-1]
ENST00000467517; ENSP00000420551; ENSG00000164867 [P29474-3]
ENST00000484524; ENSP00000420215; ENSG00000164867 [P29474-2]
GeneIDi4846
KEGGihsa:4846
UCSCiuc003wif.4 human [P29474-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4846
DisGeNETi4846
EuPathDBiHostDB:ENSG00000164867.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NOS3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0033558
HGNCiHGNC:7876 NOS3
HPAiCAB002168
MalaCardsiNOS3
MIMi163729 gene+phenotype
neXtProtiNX_P29474
OpenTargetsiENSG00000164867
PharmGKBiPA254

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1158 Eukaryota
COG0369 LUCA
COG4362 LUCA
GeneTreeiENSGT00940000161389
HOGENOMiHOG000111088
HOVERGENiHBG079617
InParanoidiP29474
KOiK13242
OMAiFQASCET
OrthoDBiEOG091G10Z0
PhylomeDBiP29474
TreeFamiTF324410

Enzyme and pathway databases

BioCyciMetaCyc:HS09149-MONOMER
BRENDAi1.14.13.39 2681
ReactomeiR-HSA-1222556 ROS, RNS production in phagocytes
R-HSA-1474151 Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation
R-HSA-203615 eNOS activation
R-HSA-203641 NOSTRIN mediated eNOS trafficking
R-HSA-203754 NOSIP mediated eNOS trafficking
R-HSA-392154 Nitric oxide stimulates guanylate cyclase
R-HSA-5218920 VEGFR2 mediated vascular permeability
SignaLinkiP29474
SIGNORiP29474

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NOS3 human
EvolutionaryTraceiP29474

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Endothelial_NOS

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4846

Protein Ontology

More...
PROi
PR:P29474

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164867 Expressed in 96 organ(s), highest expression level in spleen
CleanExiHS_NOS3
ExpressionAtlasiP29474 baseline and differential
GenevisibleiP29474 HS

Family and domain databases

Gene3Di1.20.990.10, 1 hit
3.40.50.360, 1 hit
3.40.50.80, 1 hit
InterProiView protein in InterPro
IPR003097 CysJ-like_FAD-binding
IPR017927 FAD-bd_FR_type
IPR001094 Flavdoxin-like
IPR008254 Flavodoxin/NO_synth
IPR001709 Flavoprot_Pyr_Nucl_cyt_Rdtase
IPR029039 Flavoprotein-like_sf
IPR039261 FNR_nucleotide-bd
IPR023173 NADPH_Cyt_P450_Rdtase_alpha
IPR012144 NOS_euk
IPR004030 NOS_N
IPR036119 NOS_N_sf
IPR001433 OxRdtase_FAD/NAD-bd
IPR017938 Riboflavin_synthase-like_b-brl
PfamiView protein in Pfam
PF00667 FAD_binding_1, 1 hit
PF00258 Flavodoxin_1, 1 hit
PF00175 NAD_binding_1, 1 hit
PF02898 NO_synthase, 1 hit
PIRSFiPIRSF000333 NOS, 1 hit
PRINTSiPR00369 FLAVODOXIN
PR00371 FPNCR
SUPFAMiSSF52218 SSF52218, 1 hit
SSF52343 SSF52343, 1 hit
SSF56512 SSF56512, 1 hit
SSF63380 SSF63380, 1 hit
PROSITEiView protein in PROSITE
PS51384 FAD_FR, 1 hit
PS50902 FLAVODOXIN_LIKE, 1 hit
PS60001 NOS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNOS3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P29474
Secondary accession number(s): A0S0A7
, A0S0A8, A8KA63, B2RCQ1, E9PFR2, Q13662, Q14251, Q14434, Q548C1, Q6GSL5, Q9UDC6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: March 28, 2018
Last modified: December 5, 2018
This is version 224 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again