Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 218 (29 Sep 2021)
Sequence version 1 (01 Dec 1992)
Previous versions | rss
Add a publicationFeedback
Protein

Inositol monophosphatase 1

Gene

IMPA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. Has broad substrate specificity and can use myo-inositol monophosphates, myo-inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo-inositol-phosphate, D-galactose 1-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates.

3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+2 Publications3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activity with myo-inositol monophosphate and D-galactose 1-phosphate is inhibited by Li+, Ca2+ and Mn2+, but also by Mg2+ at concentrations above 3 mM.3 Publications

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=42 µM for D-myo-inositol 1-phosphate1 Publication
  2. KM=62 µM for L-myo-inositol 1-phosphate1 Publication

pH dependencei

Optimum pH is 7.0-7.5.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: myo-inositol biosynthesis

This protein is involved in step 2 of the subpathway that synthesizes myo-inositol from D-glucose 6-phosphate. This subpathway is part of the pathway myo-inositol biosynthesis, which is itself part of Polyol metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes myo-inositol from D-glucose 6-phosphate, the pathway myo-inositol biosynthesis and in Polyol metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi70Magnesium 1; catalytic2 Publications2 Publications1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei70Substrate1 Publication1 Publication1
Metal bindingi90Magnesium 1; catalytic2 Publications2 Publications1
Metal bindingi90Magnesium 22 Publications1
Metal bindingi92Magnesium 1; via carbonyl oxygen; catalytic2 Publications2 Publications1
Metal bindingi93Magnesium 22 Publications1
Binding sitei213Substrate1 Publication1 Publication1
Metal bindingi220Magnesium 22 Publications1
Binding sitei220Substrate1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandLithium, Magnesium, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS05783-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.3.25, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P29218

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1855183, Synthesis of IP2, IP, and Ins in the cytosol

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
P29218

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00823;UER00788

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Inositol monophosphatase 1 (EC:3.1.3.255 Publications)
Short name:
IMP 1
Short name:
IMPase 1
Alternative name(s):
D-galactose 1-phosphate phosphatase1 Publication (EC:3.1.3.941 Publication)
Inositol-1(or 4)-monophosphatase 1
Lithium-sensitive myo-inositol monophosphatase A1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:IMPA1
Synonyms:IMPA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6050, IMPA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602064, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P29218

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000133731

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mental retardation, autosomal recessive 59 (MRT59)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of mental retardation, a disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. MRT59 transmission pattern is consistent with autosomal recessive inheritance.
Related information in OMIM

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi36K → Q: 50-fold reduction in activity. 1 Publication1
Mutagenesisi93D → N: Loss of activity. 1 Publication1
Mutagenesisi165S → A or I: Reduced enzyme activity with myo-inositol 1-phosphate. 1 Publication1
Mutagenesisi213E → Q: Strongly reduced affinity for myo-inositol 1-phosphate and strongly reduced enzyme activity with myo-inositol 1-phosphate. 1 Publication1

Keywords - Diseasei

Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
3612

MalaCards human disease database

More...
MalaCardsi
IMPA1
MIMi617323, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000133731

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29860

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P29218, Tclin

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1786

Drug and drug target database

More...
DrugBanki
DB03542, L-Myo-Inositol-1-Phosphate
DB14509, Lithium carbonate
DB01356, Lithium cation
DB14507, Lithium citrate
DB14508, Lithium succinate

DrugCentral

More...
DrugCentrali
P29218

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1463

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
IMPA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
127717

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001425131 – 277Inositol monophosphatase 1Add BLAST277

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei168PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P29218

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P29218

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P29218

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P29218

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P29218

PeptideAtlas

More...
PeptideAtlasi
P29218

PRoteomics IDEntifications database

More...
PRIDEi
P29218

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
54529 [P29218-1]
54530 [P29218-2]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00020906

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
P29218

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
IMPA1

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
P29218, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P29218

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P29218

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P29218

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000133731, Expressed in secondary oocyte and 244 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P29218, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P29218, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000133731, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
109825, 33 interactors

Protein interaction database and analysis system

More...
IntActi
P29218, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000408526

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P29218, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1277
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P29218

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P29218

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni92 – 95Substrate binding1 Publication1 Publication4
Regioni194 – 196Substrate binding1 Publication3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2951, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154634

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_044118_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P29218

Identification of Orthologs from Complete Genome Data

More...
OMAi
RVDGYWE

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P29218

TreeFam database of animal gene trees

More...
TreeFami
TF313194

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01639, IMPase, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033942, IMPase
IPR020583, Inositol_monoP_metal-BS
IPR020552, Inositol_monoPase_Li-sen
IPR000760, Inositol_monophosphatase-like
IPR020550, Inositol_monophosphatase_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00459, Inositol_P, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00377, IMPHPHTASES
PR00378, LIIMPHPHTASE

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00629, IMP_1, 1 hit
PS00630, IMP_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P29218-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADPWQECMD YAVTLARQAG EVVCEAIKNE MNVMLKSSPV DLVTATDQKV
60 70 80 90 100
EKMLISSIKE KYPSHSFIGE ESVAAGEKSI LTDNPTWIID PIDGTTNFVH
110 120 130 140 150
RFPFVAVSIG FAVNKKIEFG VVYSCVEGKM YTARKGKGAF CNGQKLQVSQ
160 170 180 190 200
QEDITKSLLV TELGSSRTPE TVRMVLSNME KLFCIPVHGI RSVGTAAVNM
210 220 230 240 250
CLVATGGADA YYEMGIHCWD VAGAGIIVTE AGGVLMDVTG GPFDLMSRRV
260 270
IAANNRILAE RIAKEIQVIP LQRDDED
Length:277
Mass (Da):30,189
Last modified:December 1, 1992 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i861D5617E1C04627
GO
Isoform 2 (identifier: P29218-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-277: DITKSLLVTE...VIPLQRDDED → GSGVLEQQLL...ALLLLKLVAC

Show »
Length:198
Mass (Da):21,956
Checksum:i59A26CFDC77422ED
GO
Isoform 3 (identifier: P29218-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGQRPGPVLPAVAVLGQVAKRKVAWLLRWKAVTRTETAGNSSGVYGFGKMKIFVKYFQKM

Show »
Length:336
Mass (Da):36,695
Checksum:i5838EB952D0C2FA6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RGY4E5RGY4_HUMAN
Inositol-1-monophosphatase
IMPA1
211Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIP7E5RIP7_HUMAN
Inositol-1-monophosphatase
IMPA1
180Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBL1H0YBL1_HUMAN
Inositol-1-monophosphatase
IMPA1
265Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHE9E5RHE9_HUMAN
Inositol-phosphate phosphatase
IMPA1
126Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RI82E5RI82_HUMAN
Inositol monophosphatase 1
IMPA1
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RG94E5RG94_HUMAN
Inositol monophosphatase 1
IMPA1
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIF4E5RIF4_HUMAN
Inositol monophosphatase 1
IMPA1
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RG13E5RG13_HUMAN
Inositol monophosphatase 1
IMPA1
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 3 (identifier: P29218-3)
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti17Q → R in BAH13340 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049600109I → V. Corresponds to variant dbSNP:rs204781Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0463081M → MGQRPGPVLPAVAVLGQVAK RKVAWLLRWKAVTRTETAGN SSGVYGFGKMKIFVKYFQKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_042521153 – 277DITKS…RDDED → GSGVLEQQLLICALWQLAEQ MHIMKWEFTAGMLQELALLL LKLVAC in isoform 2. 1 PublicationAdd BLAST125

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X66922 mRNA Translation: CAA47359.1
Y11360 Y11366 Genomic DNA Translation: CAA72195.1
AF042729 mRNA Translation: AAB97468.1
AK297078 mRNA Translation: BAG59595.1
AK300750 mRNA Translation: BAH13340.1
AK312823 mRNA Translation: BAG35680.1
AC090255 Genomic DNA No translation available.
CH471068 Genomic DNA Translation: EAW87095.1
BC008381 mRNA Translation: AAH08381.1
BC009565 mRNA Translation: AAH09565.1
AF178754 Genomic DNA Translation: AAD52997.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47883.1 [P29218-3]
CCDS47884.1 [P29218-2]
CCDS6231.1 [P29218-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S23130

NCBI Reference Sequences

More...
RefSeqi
NP_001138350.1, NM_001144878.1 [P29218-3]
NP_001138351.1, NM_001144879.1 [P29218-2]
NP_005527.1, NM_005536.3 [P29218-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000256108; ENSP00000256108; ENSG00000133731 [P29218-1]
ENST00000311489; ENSP00000311803; ENSG00000133731 [P29218-2]
ENST00000449740; ENSP00000408526; ENSG00000133731 [P29218-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3612

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3612

UCSC genome browser

More...
UCSCi
uc003ych.3, human [P29218-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X66922 mRNA Translation: CAA47359.1
Y11360 Y11366 Genomic DNA Translation: CAA72195.1
AF042729 mRNA Translation: AAB97468.1
AK297078 mRNA Translation: BAG59595.1
AK300750 mRNA Translation: BAH13340.1
AK312823 mRNA Translation: BAG35680.1
AC090255 Genomic DNA No translation available.
CH471068 Genomic DNA Translation: EAW87095.1
BC008381 mRNA Translation: AAH08381.1
BC009565 mRNA Translation: AAH09565.1
AF178754 Genomic DNA Translation: AAD52997.1
CCDSiCCDS47883.1 [P29218-3]
CCDS47884.1 [P29218-2]
CCDS6231.1 [P29218-1]
PIRiS23130
RefSeqiNP_001138350.1, NM_001144878.1 [P29218-3]
NP_001138351.1, NM_001144879.1 [P29218-2]
NP_005527.1, NM_005536.3 [P29218-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AWBX-ray2.50A/B2-277[»]
1IMAX-ray2.30A/B1-277[»]
1IMBX-ray2.20A/B1-277[»]
1IMCX-ray2.60A/B1-277[»]
1IMDX-ray2.60A/B1-277[»]
1IMEX-ray2.25A/B1-277[»]
1IMFX-ray2.50A1-277[»]
2HHMX-ray2.10A/B2-277[»]
4AS4X-ray1.70A/B1-277[»]
6GIUX-ray1.39A/B1-277[»]
6GJ0X-ray1.73A/B1-277[»]
6ZK0X-ray1.47AAA/BBB1-277[»]
SMRiP29218
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi109825, 33 interactors
IntActiP29218, 7 interactors
STRINGi9606.ENSP00000408526

Chemistry databases

ChEMBLiCHEMBL1786
DrugBankiDB03542, L-Myo-Inositol-1-Phosphate
DB14509, Lithium carbonate
DB01356, Lithium cation
DB14507, Lithium citrate
DB14508, Lithium succinate
DrugCentraliP29218
GuidetoPHARMACOLOGYi1463

PTM databases

DEPODiIMPA1
GlyGeniP29218, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP29218
PhosphoSitePlusiP29218
SwissPalmiP29218

Genetic variation databases

BioMutaiIMPA1
DMDMi127717

2D gel databases

REPRODUCTION-2DPAGEiIPI00020906
UCD-2DPAGEiP29218

Proteomic databases

EPDiP29218
jPOSTiP29218
MassIVEiP29218
MaxQBiP29218
PaxDbiP29218
PeptideAtlasiP29218
PRIDEiP29218
ProteomicsDBi54529 [P29218-1]
54530 [P29218-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25334, 146 antibodies

The DNASU plasmid repository

More...
DNASUi
3612

Genome annotation databases

EnsembliENST00000256108; ENSP00000256108; ENSG00000133731 [P29218-1]
ENST00000311489; ENSP00000311803; ENSG00000133731 [P29218-2]
ENST00000449740; ENSP00000408526; ENSG00000133731 [P29218-3]
GeneIDi3612
KEGGihsa:3612
UCSCiuc003ych.3, human [P29218-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3612
DisGeNETi3612

GeneCards: human genes, protein and diseases

More...
GeneCardsi
IMPA1
HGNCiHGNC:6050, IMPA1
HPAiENSG00000133731, Low tissue specificity
MalaCardsiIMPA1
MIMi602064, gene
617323, phenotype
neXtProtiNX_P29218
OpenTargetsiENSG00000133731
PharmGKBiPA29860
VEuPathDBiHostDB:ENSG00000133731

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2951, Eukaryota
GeneTreeiENSGT00940000154634
HOGENOMiCLU_044118_1_0_1
InParanoidiP29218
OMAiRVDGYWE
PhylomeDBiP29218
TreeFamiTF313194

Enzyme and pathway databases

UniPathwayiUPA00823;UER00788
BioCyciMetaCyc:HS05783-MONOMER
BRENDAi3.1.3.25, 2681
PathwayCommonsiP29218
ReactomeiR-HSA-1855183, Synthesis of IP2, IP, and Ins in the cytosol
SABIO-RKiP29218

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
3612, 8 hits in 1019 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
IMPA1, human
EvolutionaryTraceiP29218

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
IMPA1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3612
PharosiP29218, Tclin

Protein Ontology

More...
PROi
PR:P29218
RNActiP29218, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000133731, Expressed in secondary oocyte and 244 other tissues
ExpressionAtlasiP29218, baseline and differential
GenevisibleiP29218, HS

Family and domain databases

CDDicd01639, IMPase, 1 hit
InterProiView protein in InterPro
IPR033942, IMPase
IPR020583, Inositol_monoP_metal-BS
IPR020552, Inositol_monoPase_Li-sen
IPR000760, Inositol_monophosphatase-like
IPR020550, Inositol_monophosphatase_CS
PfamiView protein in Pfam
PF00459, Inositol_P, 1 hit
PRINTSiPR00377, IMPHPHTASES
PR00378, LIIMPHPHTASE
PROSITEiView protein in PROSITE
PS00629, IMP_1, 1 hit
PS00630, IMP_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIMPA1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P29218
Secondary accession number(s): B2R733
, B4DLN3, B7Z6Q4, J3KQT7, Q9UK71
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: December 1, 1992
Last modified: September 29, 2021
This is version 218 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again