Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated protein tau

Gene

MAPT

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-BTA-264870 Caspase-mediated cleavage of cytoskeletal proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule-associated protein tau
Alternative name(s):
Neurofibrillary tangle protein
Paired helical filament-tau
Short name:
PHF-tau
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAPT
Synonyms:TAU
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiBos taurus (Bovine)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9913 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000009136 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Vertebrate Gene Nomenclature Database

More...
VGNCi
VGNC:57143 MAPT

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3638363

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000727362 – 448Microtubule-associated protein tauAdd BLAST447

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei19PhosphotyrosineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki33Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei35PhosphoserineBy similarity1
Modified residuei50PhosphoserineBy similarity1
Modified residuei58PhosphothreonineBy similarity1
Modified residuei60PhosphothreonineBy similarity1
Modified residuei100PhosphothreonineBy similarity1
Modified residuei144PhosphothreonineBy similarity1
Modified residuei146Omega-N-methylarginineBy similarity1
Modified residuei154N6,N6-dimethyllysine; alternateBy similarity1
Modified residuei154N6-acetyllysine; alternateBy similarity1
Modified residuei160PhosphothreonineBy similarity1
Modified residuei166PhosphothreonineBy similarity1
Modified residuei167PhosphothreonineBy similarity1
Modified residuei172PhosphothreonineBy similarity1
Modified residuei198PhosphoserineBy similarity1
Modified residuei202PhosphoserineBy similarity1
Modified residuei204PhosphotyrosineBy similarity1
Modified residuei205PhosphoserineBy similarity1
Modified residuei206PhosphoserineBy similarity1
Modified residuei209PhosphoserineBy similarity1
Modified residuei212PhosphothreonineBy similarity1
Modified residuei219PhosphothreonineBy similarity1
Modified residuei221PhosphoserineBy similarity1
Modified residuei224PhosphothreonineBy similarity1
Modified residuei232N6-acetyllysineBy similarity1
Modified residuei238PhosphothreonineBy similarity1
Modified residuei242PhosphoserineBy similarity1
Modified residuei244PhosphoserineBy similarity1
Cross-linki261Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei266N6-acetyllysine; alternateBy similarity1
Modified residuei266N6-methyllysine; alternateBy similarity1
Cross-linki266Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei269PhosphoserineBy similarity1
Cross-linki274Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei288N6-acetyllysine; alternateBy similarity1
Cross-linki288Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei292PhosphoserineBy similarity1
Modified residuei296PhosphoserineBy similarity1
Modified residuei297N6-acetyllysineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi298 ↔ 329By similarity
Modified residuei300PhosphoserineBy similarity1
Modified residuei305N6-acetyllysine; alternateBy similarity1
Cross-linki305Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei312PhosphoserineBy similarity1
Modified residuei318N6,N6-dimethyllysine; alternateBy similarity1
Modified residuei318N6-acetyllysine; alternateBy similarity1
Cross-linki318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei324N6-acetyllysine; alternateBy similarity1
Cross-linki324Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei328N6-acetyllysine; alternateBy similarity1
Cross-linki328Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei331PhosphoserineBy similarity1
Modified residuei338N6-acetyllysine; alternateBy similarity1
Cross-linki338Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei350N6-acetyllysine; alternateBy similarity1
Cross-linki350Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei354N6-acetyllysine; alternateBy similarity1
Cross-linki354Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei356Omega-N-methylarginineBy similarity1
Modified residuei359PhosphoserineBy similarity1
Cross-linki360Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei363PhosphoserineBy similarity1
Modified residuei376N6-acetyllysine; alternateBy similarity1
Cross-linki376Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Cross-linki382Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)By similarity
Modified residuei392N6-acetyllysine; alternateBy similarity1
Cross-linki392Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternateBy similarity
Modified residuei401PhosphotyrosineBy similarity1
Modified residuei403PhosphoserineBy similarity1
Modified residuei407PhosphoserineBy similarity1
Modified residuei410PhosphothreonineBy similarity1
Modified residuei411PhosphoserineBy similarity1
Modified residuei416PhosphoserineBy similarity1
Modified residuei423PhosphoserineBy similarity1
Modified residuei429PhosphoserineBy similarity1
Modified residuei434PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Polyubiquitinated. Requires functional TRAF6 and may provoke SQSTM1-dependent degradation by the proteasome (By similarity).By similarity
Phosphorylation at various serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK1, CDK1, CDK5, GSK3, MAPK) (a few sites per protein in interphase, more in mitosis), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1, MARK2, MARK3, MARK4), causing detachment from microtubules, and their disassembly (By similarity). Phosphorylation at Ser-269 by BRSK1 and BRSK2 in neurons affects ability to bind microtubules and plays a role in neuron polarization. Phosphorylated by PHK. Dephosphorylation at several serine and threonine residues by the serine/threonine phosphatase PPP5C (By similarity).By similarity
O-glycosylated; contains at least 4 GlcNAc. Site-specific or stoichiometric changes in glycosylation may modulate tau function and also play a role in PHF's formation.1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P29172

PRoteomics IDEntifications database

More...
PRIDEi
P29172

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P29172

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in neurons.

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

During neurite outgrowth.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSBTAG00000017512 Expressed in 9 organ(s), highest expression level in prefrontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P29172 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MARK1, MARK2, MARK3 AND MARK4 (By similarity). Interacts with SQSTM1 when polyubiquitinated. Interacts with PSMC2 through SQSTM1 (By similarity). Interacts with FKBP4. Binds to CSNK1D (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
YWHAZP631042EBI-7291149,EBI-347088From Homo sapiens.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
158649, 4 interactors

Protein interaction database and analysis system

More...
IntActi
P29172, 4 interactors

Molecular INTeraction database

More...
MINTi
P29172

STRING: functional protein association networks

More...
STRINGi
9913.ENSBTAP00000054412

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P29172

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P29172

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati251 – 281Tau/MAP 1PROSITE-ProRule annotationAdd BLAST31
Repeati282 – 312Tau/MAP 2PROSITE-ProRule annotationAdd BLAST31
Repeati313 – 343Tau/MAP 3PROSITE-ProRule annotationAdd BLAST31
Repeati344 – 375Tau/MAP 4PROSITE-ProRule annotationAdd BLAST32

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The tau/MAP repeat binds to tubulin. Type I isoforms contain 3 repeats while type II isoforms contain 4 repeats.

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2418 Eukaryota
ENOG4111J07 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155494

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000991

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P29172

KEGG Orthology (KO)

More...
KOi
K04380

Identification of Orthologs from Complete Genome Data

More...
OMAi
HISIENH

Database of Orthologous Groups

More...
OrthoDBi
1008734at2759

TreeFam database of animal gene trees

More...
TreeFami
TF316358

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001084 MAP_tubulin-bd_rpt
IPR002955 Tau

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00418 Tubulin-binding, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01261 TAUPROTEIN

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00229 TAU_MAP_1, 4 hits
PS51491 TAU_MAP_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (20+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 20 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 6 of the 14 exons. One of these optional exons contains the additional tau/MAP repeat. Tau-A cDNA has been constructed from two overlapping cDNAs by PubMed:2498649: Tau-G and Tau-H sequences begin with exon 6 or a part of it (exon 6 is missing in isoforms that begin with exon 1). 3 different C-termini are obtained either by the retention or the splicing of intron 13/14 (2 different 5' splice donors).

This entry has 20 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform Tau-A (identifier: P29172-1) [UniParc]FASTAAdd to basket
Also known as: PBT43I12

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEPRQEFDV MEDHAQGDYT LQDQEGDMDP GLKESPLQTP ADDGSEEPGS
60 70 80 90 100
ETSDAKSTPT AEDATAPLVD EGAPGEQAAA QAPAEIPEGT AAEEAGIGDT
110 120 130 140 150
SNLEDQAAGH VTQARMVSKG KDGTGPDDKK TKGADGKPGT KIATPRGAAP
160 170 180 190 200
PGQKGQANAT RIPAKTTPTP KTSPATMQVQ KKPPPAGAKS ERGESGKSGD
210 220 230 240 250
RSGYSSPGSP GTPGSRSRTP SLPTPPTREP KKVAVVRTPP KSPSAAKSRL
260 270 280 290 300
QAAPGPMPDL KNVKSKIGST ENLKHQPGGG KVQIINKKLD LSNVQSKCGS
310 320 330 340 350
KDNIKHVPGG GSVQIVYKPV DLSKVTSKCG SLGNIHHKPG GGQVEVKSEK
360 370 380 390 400
LDFKDRVQSK IGSLDNITHV PGGGNKKIET HKLTFRENAK AKTDHGAEIV
410 420 430 440
YKSPVVSGDT SPRHLSNVSS TGSIDMVDSP QLATLADEVS ASLAKQGL
Length:448
Mass (Da):46,333
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i821638A9C4809602
GO
Isoform Tau-B (identifier: P29172-2) [UniParc]FASTAAdd to basket
Also known as: PBT43-12

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.

Show »
Length:430
Mass (Da):44,426
Checksum:i9A7A06EFB6895ACD
GO
Isoform Tau-C (identifier: P29172-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-192: Missing.
     282-312: Missing.

Show »
Length:399
Mass (Da):41,180
Checksum:i6D446DCDC0AA66F2
GO
Isoform Tau-D (identifier: P29172-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.

Show »
Length:419
Mass (Da):43,603
Checksum:iA45E9316169C57BC
GO
Isoform Tau-E (identifier: P29172-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.

Show »
Length:401
Mass (Da):41,696
Checksum:iEF098A6D436C5450
GO
Isoform Tau-F (identifier: P29172-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.

Show »
Length:370
Mass (Da):38,450
Checksum:i225B352519AAC090
GO
Isoform Tau-G (identifier: P29172-7) [UniParc]FASTAAdd to basket
Also known as: PBT4

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: MAEPRQEFDV...DGTGPDDKKT → MPLNHYLPYL...NSGAKEMKVK
     175-192: Missing.

Show »
Length:403
Mass (Da):42,361
Checksum:iF36BAF6A1BFCF36D
GO
Isoform Tau-H (identifier: P29172-8) [UniParc]FASTAAdd to basket
Also known as: PBT7

The sequence of this isoform differs from the canonical sequence as follows:
     1-131: MAEPRQEFDV...DGTGPDDKKT → MKVK
     175-192: Missing.

Show »
Length:303
Mass (Da):31,420
Checksum:i7DF858C2EAD31A03
GO
Isoform Tau-I (identifier: P29172-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:477
Mass (Da):49,383
Checksum:i1B0AC87B27070C23
GO
Isoform Tau-J (identifier: P29172-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:430
Mass (Da):44,747
Checksum:iD75BD68C7085B7B7
GO
Isoform Tau-K (identifier: P29172-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:399
Mass (Da):41,500
Checksum:iE2CF718753CE169A
GO
Isoform Tau-L (identifier: P29172-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:426
Mass (Da):44,458
Checksum:iB2ABCB5CD3DC4B82
GO
Isoform Tau-M (identifier: P29172-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:408
Mass (Da):42,552
Checksum:i27B9A11F85B4E29A
GO
Isoform Tau-N (identifier: P29172-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     439-448: VSASLAKQGL → PCVCPHHACVSAVRSLVTACPLTTSCCPEFPASPPTPSR

Show »
Length:377
Mass (Da):39,305
Checksum:iFF2F16682EF06E96
GO
Isoform Tau-O (identifier: P29172-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:516
Mass (Da):53,884
Checksum:iE73FCB53C3678CCA
GO
Isoform Tau-P (identifier: P29172-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:469
Mass (Da):49,248
Checksum:i913E117E5F1BC2A5
GO
Isoform Tau-Q (identifier: P29172-17) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:438
Mass (Da):46,002
Checksum:i438E48674EB03EEB
GO
Isoform Tau-R (identifier: P29172-18) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:465
Mass (Da):48,959
Checksum:iCD8C23689F259F95
GO
Isoform Tau-S (identifier: P29172-19) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:447
Mass (Da):47,053
Checksum:iCB410E5C23BC1AA1
GO
Isoform Tau-T (identifier: P29172-20) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-91: Missing.
     92-113: Missing.
     175-192: Missing.
     282-312: Missing.
     447-448: GL → ALRLPPPRLCVCRAEPGHCLSPHYVMLSRVPRLATHPFSVMDIVPMGRHLLYTKGEVKEGEVQTPGPPSL

Show »
Length:416
Mass (Da):43,806
Checksum:i430F6DB600ECFEA7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3N2J1G3N2J1_BOVIN
Microtubule-associated protein
MAPT
403Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0031651 – 131MAEPR…DDKKT → MPLNHYLPYLFLVSVLFQFV PFSHVLTFILILFMFMFKPS TPSSAKTLKNRPCLSPKRPT PGSSDPLIKPSSPAVCPEPS SSPKHVSSVTPRTGNSGAKE MKVK in isoform Tau-G. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_0031661 – 131MAEPR…DDKKT → MKVK in isoform Tau-H. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_00316763 – 91Missing in isoform Tau-D, isoform Tau-E, isoform Tau-F, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_00316892 – 113Missing in isoform Tau-L, isoform Tau-M, isoform Tau-N, isoform Tau-R, isoform Tau-S and isoform Tau-T. CuratedAdd BLAST22
Alternative sequenceiVSP_003169175 – 192Missing in isoform Tau-B, isoform Tau-C, isoform Tau-E, isoform Tau-F, isoform Tau-G, isoform Tau-H, isoform Tau-J, isoform Tau-K, isoform Tau-M, isoform Tau-N, isoform Tau-P, isoform Tau-Q, isoform Tau-S and isoform Tau-T. 2 PublicationsAdd BLAST18
Alternative sequenceiVSP_003170282 – 312Missing in isoform Tau-C, isoform Tau-F, isoform Tau-K, isoform Tau-N, isoform Tau-Q and isoform Tau-T. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_003171439 – 448VSASLAKQGL → PCVCPHHACVSAVRSLVTAC PLTTSCCPEFPASPPTPSR in isoform Tau-I, isoform Tau-J, isoform Tau-K, isoform Tau-L, isoform Tau-M and isoform Tau-N. Curated10
Alternative sequenceiVSP_003172447 – 448GL → ALRLPPPRLCVCRAEPGHCL SPHYVMLSRVPRLATHPFSV MDIVPMGRHLLYTKGEVKEG EVQTPGPPSL in isoform Tau-O, isoform Tau-P, isoform Tau-Q, isoform Tau-R, isoform Tau-S and isoform Tau-T. Curated2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L34953
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951, L34952 Genomic DNA Translation: AAA51609.1
M26157 mRNA Translation: AAA30770.1
M26158 mRNA Translation: AAA30771.1
M26178
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51601.1 Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51602.1 Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34950, L34951 Genomic DNA Translation: AAA51603.1 Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51604.1 Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51605.1 Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34950, L34951 Genomic DNA Translation: AAA51606.1 Sequence problems.
BC109941 mRNA Translation: AAI09942.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A31939 QRBOT1
B31939 QRBOT2

NCBI Reference Sequences

More...
RefSeqi
NP_776531.1, NM_174106.2 [P29172-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Bt.34217

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSBTAT00000023284; ENSBTAP00000023284; ENSBTAG00000017512 [P29172-1]
ENSBTAT00000042687; ENSBTAP00000040320; ENSBTAG00000017512 [P29172-3]
ENSBTAT00000064492; ENSBTAP00000054412; ENSBTAG00000017512 [P29172-15]
ENSBTAT00000064966; ENSBTAP00000054994; ENSBTAG00000017512 [P29172-2]
ENSBTAT00000065509; ENSBTAP00000056351; ENSBTAG00000017512 [P29172-4]
ENSBTAT00000065660; ENSBTAP00000056547; ENSBTAG00000017512 [P29172-18]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
281296

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
bta:281296

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34953
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951, L34952 Genomic DNA Translation: AAA51609.1
M26157 mRNA Translation: AAA30770.1
M26158 mRNA Translation: AAA30771.1
M26178
, L34940, L34941, L34942, L34943, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51601.1 Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51602.1 Sequence problems.
M26178
, L34940, L34941, L34943, L34944, L34946, L34948, L34950, L34951 Genomic DNA Translation: AAA51603.1 Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34947, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51604.1 Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34949, L34950, L34951 Genomic DNA Translation: AAA51605.1 Sequence problems.
M26178
, L34940, L34941, L34944, L34946, L34948, L34950, L34951 Genomic DNA Translation: AAA51606.1 Sequence problems.
BC109941 mRNA Translation: AAI09942.1
PIRiA31939 QRBOT1
B31939 QRBOT2
RefSeqiNP_776531.1, NM_174106.2 [P29172-1]
UniGeneiBt.34217

3D structure databases

SMRiP29172
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi158649, 4 interactors
IntActiP29172, 4 interactors
MINTiP29172
STRINGi9913.ENSBTAP00000054412

Chemistry databases

BindingDBiP29172
ChEMBLiCHEMBL3638363

PTM databases

iPTMnetiP29172

Proteomic databases

PaxDbiP29172
PRIDEiP29172

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000023284; ENSBTAP00000023284; ENSBTAG00000017512 [P29172-1]
ENSBTAT00000042687; ENSBTAP00000040320; ENSBTAG00000017512 [P29172-3]
ENSBTAT00000064492; ENSBTAP00000054412; ENSBTAG00000017512 [P29172-15]
ENSBTAT00000064966; ENSBTAP00000054994; ENSBTAG00000017512 [P29172-2]
ENSBTAT00000065509; ENSBTAP00000056351; ENSBTAG00000017512 [P29172-4]
ENSBTAT00000065660; ENSBTAP00000056547; ENSBTAG00000017512 [P29172-18]
GeneIDi281296
KEGGibta:281296

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4137
VGNCiVGNC:57143 MAPT

Phylogenomic databases

eggNOGiKOG2418 Eukaryota
ENOG4111J07 LUCA
GeneTreeiENSGT00940000155494
HOVERGENiHBG000991
InParanoidiP29172
KOiK04380
OMAiHISIENH
OrthoDBi1008734at2759
TreeFamiTF316358

Enzyme and pathway databases

ReactomeiR-BTA-264870 Caspase-mediated cleavage of cytoskeletal proteins

Gene expression databases

BgeeiENSBTAG00000017512 Expressed in 9 organ(s), highest expression level in prefrontal cortex
ExpressionAtlasiP29172 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR001084 MAP_tubulin-bd_rpt
IPR002955 Tau
PfamiView protein in Pfam
PF00418 Tubulin-binding, 4 hits
PRINTSiPR01261 TAUPROTEIN
PROSITEiView protein in PROSITE
PS00229 TAU_MAP_1, 4 hits
PS51491 TAU_MAP_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTAU_BOVIN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P29172
Secondary accession number(s): P29173
, Q28185, Q28186, Q28187, Q28188, Q28189, Q28190, Q32KT2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: January 23, 2007
Last modified: January 16, 2019
This is version 159 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again